KEGG   Methanotorris igneus: Metig_1155Help
Entry
Metig_1155        CDS       T01510                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mig  Methanotorris igneus
Brite
Enzymes [BR:mig01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Metig_1155
Transfer RNA biogenesis [BR:mig03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Metig_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1158756..1160369)
Genome map
AA seq 537 aa AA seqDB search
MDDYEKFMRCIIENILNEYEKKKKVSKDRIEQIKSKCLRKFRHLNVGFPLNSEILKYATE
EEKKVLIPLLRKKPVRTLSGVAVVAVMTSPEKCPHGKCMFCPGGKGSVFGDVPQSYTGRE
PATMRGLMYKFDPYEQTKARLEQLEKVGHPTNKVELIIMGGTFPARDIEYQDWFIKGCLD
AMNKKVSNSLEEAQKLNETAEHRCVALCIETRPDYCREEHINQMLKLGATRVELGVQSIY
NDVLKFVKRGHTVEDTIKATQLLKDSGLKVSYHMMPGLPNTTEEMDKKMFYEIFNNPDFK
PDLIKIYPCLVVRGTEIYDLWKKGEFKPLNDEEAVELISYVKSIMPKWVRTSRIQRDIPA
TVIVDGVKKSNLGELVYKNLERKGIKCKCIRCREVGHVMYKRGIMPEIEHIKLCREEYIA
SGGTEIFLSYEDLKNDILIAYLRLRIPYKPFRKEIDDKTALVRQLHVCGQEKPLTKDIKE
ITWQHKGYGKMLLKEAERIAKEEFGMNKILVTSGIGVREYYRRLGYERIGAYMGKYL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggatgattacgagaaattcatgaggtgtataatagagaatatattgaatgaatatgaa
aagaaaaagaaggtctcaaaagacagaattgaacagataaaatcaaaatgtctaagaaaa
tttaggcatttaaatgtggggttcccattaaactctgaaatattaaaatatgcaactgaa
gaagagaaaaaagtcctcatcccattactgagaaaaaagcccgtcagaacattatctggt
gttgcggttgttgcagtaatgacatcccctgaaaaatgtccgcatggaaagtgtatgttt
tgtccagggggaaaaggtagcgtctttggagatgtgccgcaaagttatacgggaagagaa
ccagcaacaatgaggggcttgatgtataaattcgacccctacgaacaaaccaaagcaagg
ttggagcagttggagaaagttgggcatccaacaaataaggttgaactcatcattatggga
gggacatttccagcaagggatatagagtatcaagattggtttataaaaggttgcttagat
gcaatgaacaaaaaagtatcaaatagtttagaggaagcacaaaaactaaatgaaactgca
gaacatagatgtgtggctttatgcattgaaacgagacctgattattgtagagaggaacat
ataaaccaaatgctaaaattgggggccacaagggtagaacttggggttcagagtatatac
aatgatgtgttaaagtttgttaaaagaggacataccgttgaagatacaataaaggcaacg
caattgttaaaggatagtggtttaaaggtttcttaccacatgatgcctggcttaccaaac
acaacagaagagatggacaaaaagatgttttatgaaatattcaacaatccagattttaag
cctgatttaatcaaaatttatccatgtttggttgttagggggacagaaatatatgatttg
tggaaaaaaggggaatttaaaccactaaatgatgaagaagcggtggaattaataagttat
gtaaagtccataatgccaaaatgggtaagaacttcaagaattcaaagggatattcctgca
actgttatcgtcgatggagttaagaagagcaatttgggagaattggtctataaaaactta
gaaaggaaaggcataaaatgtaaatgtataaggtgtagggaagttgggcatgtgatgtat
aagagaggcattatgcctgagattgagcatataaaattatgcagggaagaatatattgca
agtggaggaacagaaatcttcttatcctatgaagatttaaaaaacgatatattaatagca
tatttaaggttgagaattccatacaaaccatttagaaaggagattgatgacaaaacagca
ttggtaaggcagctccatgtttgtgggcaagaaaaacctttaacaaaggacataaaagaa
atcacatggcaacataaaggatatggaaaaatgctcctaaaagaagcagagaggattgcg
aaggaagaatttggcatgaacaaaattttggtaacaagtggtattggagttagggaatac
tacagaaggttgggatatgaaagaataggggcatatatgggtaaatatctatag

DBGET integrated database retrieval system