KEGG   Methanotorris igneus: Metig_1183Help
Entry
Metig_1183        CDS       T01510                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mig  Methanotorris igneus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Module
F420 biosynthesis
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mig00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1187158..1187904
Genome map
AA seq 248 aa AA seqDB search
MIREKRKVEVIGLELPIFKGNEHVNLAELIAQYPLEDGDVIVIAETLISKVEGNILKKED
IKPSKEAIELAKKLGKEPEVMHVILDEAKEIVKIGKNFIITETKHGFVCANSGVDESNVD
GIKPLPKNPDESAEKIRKEIEKITKKKVGVIISDSVGRPFRKGAVGVAIGVSGILALWDR
KGEKDLFGRELRTTEVAIADELASMANVVMGEANEGIPVVIIRNAPVPFGNGKGKDLIRK
KEEDVFRN
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattagagaaaagagaaaagtggaggttattgggctcgaactaccaatttttaaagga
aatgaacatgtaaatttggcagagttgattgcccaatacccattggaagatggagatgtt
attgttattgctgaaacactaatatcaaaagttgaaggcaatattttaaagaaagaggat
ataaaaccatcaaaagaggcaatagaacttgctaaaaaacttggaaaagaaccagaagtt
atgcatgttattttagatgaggcgaaggagattgtgaaaattgggaagaactttataata
accgagacaaagcatggttttgtttgtgccaatagtggagtagatgagagtaatgtggat
ggcataaaaccacttccaaaaaacccagacgaaagtgctgaaaaaataaggaaggaaatt
gaaaaaataactaaaaagaaagttggggttataatatctgatagtgttggaaggcccttt
agaaaaggagcagtaggagtagcgattggagttagtggaattttggcattatgggacagg
aagggagagaaggatttatttgggagggagttgaggacaacagaagtggctattgctgat
gaattggcgagtatggctaatgttgttatgggagaagcaaatgaaggtatcccagttgtt
attattagaaatgcaccagttccttttgggaatgggaaagggaaggatttaattagaaag
aaggaagaggatgtttttagaaattaa

DBGET integrated database retrieval system