KEGG   Methanotorris igneus: Metig_1335Help
Entry
Metig_1335        CDS       T01510                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mig  Methanotorris igneus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metig_1335
Enzymes [BR:mig01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metig_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344962..1345510
Genome map
AA seq 182 aa AA seqDB search
MDAKLFVDICHKLYERKYLVGSGGNVSVREEDLVYVTPTGSILGFLKEEDICVVNIDGEV
IKGKPTSEINMHLNLYRKREDINAIIHAHSLYSTAFSIADKKIELLTPEAEIFLKEIGYV
DYFEAGSLKLAEEVAKRDEDVIILKNHGVVCLGKDLIDAYIKIEVLEEVAKLNLIVNTLS
QK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggatgctaagttatttgtggatatatgtcacaaattatatgagagaaagtatttggtc
ggcagtggagggaacgtttcggttagggaagaggacttggtctatgtaacaccgactggt
tctattttaggttttttgaaagaggaagatatatgcgttgttaatattgatggggaagta
ataaaaggaaaaccaacatctgaaataaatatgcacctcaatctatataggaagagggaa
gatataaatgcaataatacatgcccattcattgtattcaactgcattctcaattgcagat
aaaaaaatagaacttttaactcctgaggcagagatatttttaaaagagattgggtatgta
gattactttgaggcgggaagtttgaaacttgcagaggaagttgcaaaaagagatgaggat
gtaattattttaaaaaatcatggtgttgtttgtttgggcaaggatttaatagacgcatat
ataaaaatagaggttcttgaagaagtagcaaaattaaacctcatagtaaatacactaagt
caaaaatag

DBGET integrated database retrieval system