KEGG   Methanotorris igneus: Metig_1354Help
Entry
Metig_1354        CDS       T01510                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mig  Methanotorris igneus
Pathway
mig00010  Glycolysis / Gluconeogenesis
mig00020  Citrate cycle (TCA cycle)
mig00620  Pyruvate metabolism
mig00633  Nitrotoluene degradation
mig00640  Propanoate metabolism
mig00650  Butanoate metabolism
mig00680  Methane metabolism
mig00720  Carbon fixation pathways in prokaryotes
mig01100  Metabolic pathways
mig01120  Microbial metabolism in diverse environments
mig01130  Biosynthesis of antibiotics
mig01200  Carbon metabolism
Module
mig_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mig_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_1354
   00020 Citrate cycle (TCA cycle)
    Metig_1354
   00620 Pyruvate metabolism
    Metig_1354
   00640 Propanoate metabolism
    Metig_1354
   00650 Butanoate metabolism
    Metig_1354
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metig_1354
   00680 Methane metabolism
    Metig_1354
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metig_1354
Enzymes [BR:mig01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metig_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_7 Fer4_2 Fer4_9 Fer4_16 Fer4_17 Fer4_4 Fer4_13 Fer4_8 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AEF96889
UniProt: F6BF19
Position
1371059..1371316
Genome map
AA seq 85 aa AA seqDB search
MVTIGAIIYEPGSSIRNKTGSWRVFRPILDADKCIKCENCYIFCPEGAIQEVDGKFTINY
DYCKGCLICVNECPVNAITKVREGK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggttacaattggtgcaattatatatgagccaggaagttcaattagaaacaagactggt
agttggagagtatttaggccaattttagatgcggataaatgtataaagtgtgaaaactgc
tatatattctgtccagaaggagctatacaggaagttgatgggaaattcaccattaactat
gactactgcaagggatgtttaatctgcgtaaatgagtgcccagtaaatgcaataacaaaa
gttagagaaggaaaataa

DBGET integrated database retrieval system