KEGG   Methanotorris igneus: Metig_1354Help
Entry
Metig_1354        CDS       T01510                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mig  Methanotorris igneus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mig01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mig00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mig00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mig00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mig00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mig00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mig00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mig00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1371059..1371316
Genome map
AA seq 85 aa AA seqDB search
MVTIGAIIYEPGSSIRNKTGSWRVFRPILDADKCIKCENCYIFCPEGAIQEVDGKFTINY
DYCKGCLICVNECPVNAITKVREGK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggttacaattggtgcaattatatatgagccaggaagttcaattagaaacaagactggt
agttggagagtatttaggccaattttagatgcggataaatgtataaagtgtgaaaactgc
tatatattctgtccagaaggagctatacaggaagttgatgggaaattcaccattaactat
gactactgcaagggatgtttaatctgcgtaaatgagtgcccagtaaatgcaataacaaaa
gttagagaaggaaaataa

DBGET integrated database retrieval system