KEGG   Methanotorris igneus: Metig_1397Help
Entry
Metig_1397        CDS       T01510                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mig  Methanotorris igneus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mig00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Metig_1397
Enzymes [BR:mig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Metig_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1422784..1426089)
Genome map
AA seq 1101 aa AA seqDB search
MKNLVSLVAWHDSGWNGRFCRKPEENRYCESFKYVKFNKYNSKLCLNNPSGVISTIPKGM
PCHESVMFIENNNVIKEGGNRVGRIPTLLFSNVERFKEILDYVKGKYTVIHVRENPLSDN
KVIIGCVKIKEIINKDEKNKNKLGFEIDFDLEDIVFTLPYQEFIEFCKDKNLDYKEFEHL
VVFDVEDFSRYFRGMCNIITDKTLIEILKKAIEILEGFNKFIEEYPDFMEYLKGNKAFRP
WVMKDFDKFLDRIKNVISELEGREYKYPGLPAVIYYLGDKEAYSKYFEAVESNKEEELYK
ELKESLEKRKENSDFKNEFKEFLLNYAVYYDLMAYDIKIIKEQIKKGFISLEEILENPYV
LVEDLKEKEDFSGFSFIEVDSWEQRRVKDFDKHNPYRIRALLVEILKRLLKHGHTTVTTG
EVKNIFDKIGVDISFKEFLEMIEKNEEIIKEKVVIEEKIIGNEKVKLFTLKDIKESERVI
EETINKMLDKPKEELRVSKEEIEKLLRNEKKEDEDYKKAIEMQIEAVEKLLKNRVGILTG
PAGTGKTTVISTLVKILKDKYGYEDIYILTPTGKSAMVIREKLKEKKINNVKVMTIHRFI
AQEFSDYFNFDFFVLRDVPENAKKKVYVLILDESSMIDTKILGNLFKCVDIEKHLVFVGD
INQLPPVDAGKPFHDIYRYLERVNKDAIAKLEIPLRSESKKIAEFSEIFLMDGEERKIKL
EELLKEKEVLDNKEIYRIRDGEKEVITIEVVKDNLLKALEDAIEKILEENSKDNFFEFAV
FDDKLEILSPTKTKGELNSYIINLYIRQDSKFVPEKYRDKMKLNLFYGNKYVADKVIQTK
NKYKKGIYNGMMGYVYFYNKNYKKYAIKFYSDENERRPYVYVSDDNIEHAYAITIHKSQG
SGFENIIVAIPKGLNKFVSKEMLYTAVTRAKKRLWIIVEESLENLINVYNSELRNRKTNL
FDNFDIDSLIPFYEERAIETERGEKVRSEDEKKLADIFHKLGIEYEYEPISEYLKLGVLP
DFKLCLGDKEILWEHYGVDSLDYRLRQREKEEIYKKEGYKIIKLGDIDNAKLDEKVVIIS
TPEDLNCVEEKIKILLELVEI
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacttagtttctttagtagcttggcatgactcaggatggaatggtagattttgt
agaaagccagaggagaatagatactgtgaaagctttaagtatgtaaaatttaataaatat
aattcaaaattatgcttaaacaacccttcaggagtcattagcactatccctaaaggaatg
ccatgccatgaatcagtaatgttcattgagaataataatgtaattaaagagggaggaaat
agagttggtagaattccaacattattattctcaaatgttgaaaggtttaaggaaatattg
gattatgttaaaggaaaatacactgttatacatgtgagagaaaatcctttgtctgataat
aaggttataattggctgtgtaaagattaaagaaataataaataaagatgaaaaaaataag
aacaaattaggttttgaaatagactttgatttagaggatattgtatttactctaccttat
caggagtttatagagttttgtaaagataaaaatttagactataaagagtttgaacattta
gttgtttttgatgttgaagatttcagtaggtactttagagggatgtgtaatattataact
gataaaaccctaatagaaatattaaaaaaagctatagaaattttagaaggatttaataaa
tttattgaggaatatccagactttatggagtatctaaaaggaaataaagcttttaggcca
tgggtaatgaaggattttgataagtttttagatagaataaaaaatgttatcagtgaatta
gagggtagagaatacaaataccctggattgccagcagtgatatactatttaggtgataaa
gaagcttattcaaaatattttgaagctgttgagagtaataaagaagaggagctttataag
gaattaaaagagagtttagaaaaaagaaaagagaacagtgactttaaaaatgagtttaaa
gaattcttattaaactatgcagtgtactatgatttaatggcttatgacattaaaataata
aaggaacaaataaaaaaaggattcattagcttagaggaaattttagaaaatccctatgtc
ttagttgaagatttaaaagagaaggaagatttttctggatttagttttattgaagtagat
tcctgggaacagaggagagttaaagattttgataaacataacccttacaggataagagct
ttattagttgagattttaaagaggctactaaagcacgggcatacaacagtaactactgga
gaggttaaaaatatttttgataaaattggggtagacattagctttaaagaatttttagag
atgattgagaagaatgaggaaattataaaagagaaagtagttattgaggagaagattatt
ggaaatgagaaagtaaaattgtttactttaaaagacataaaagaaagtgagagggttata
gaagaaactattaataaaatgcttgataaaccaaaagaagaacttagggttagtaaagag
gaaatagaaaagcttttgagaaatgagaaaaaagaagatgaagattataagaaagctata
gaaatgcaaatagaagctgttgaaaagctattaaaaaatagagttggcattttaactggc
ccagcaggaacagggaaaacaactgtaatatctactttagtaaaaattttaaaggataaa
tatggttatgaggatatctatatcctaactcctactggaaaatcagcaatggttattaga
gagaaattaaaggagaagaaaataaataatgtcaaagtaatgactatccatagatttata
gcccaagaatttagtgattattttaattttgatttctttgtattgagagatgttccagaa
aatgcaaagaaaaaggtctatgtcctaatattagacgagagctctatgatagacactaaa
atattagggaatttatttaaatgtgttgatatagagaagcatctggtatttgttggagac
attaaccaactacccccagtagatgctggaaagccattccatgatatttacagatactta
gagagggttaataaagatgctatagcaaaattagagattccactaagatctgaatctaag
aaaattgctgagttttcagaaatattcttaatggatggagaagaaagaaagattaagtta
gaggagttattaaaagaaaaagaagttttagataataaagaaatttatagaataagagat
ggagagaaagaggttataacaattgaagttgttaaagataatttattaaaagctttagaa
gatgctatagagaaaatattggaggagaacagcaaagataatttctttgaatttgctgta
tttgatgataagttagagatcctatctccaacaaaaacaaagggagagctaaactcttac
ataattaacctctatataaggcaagattcaaagtttgtccctgaaaaatatagagacaaa
atgaaattaaatttgttctatggaaataagtatgtagctgataaagttattcagactaaa
aataagtacaaaaaagggatttataatgggatgatgggttatgtatatttctacaataaa
aattataaaaaatatgcaataaaattctattctgatgaaaatgaaagaagaccttatgta
tatgttagtgatgataatatagaacatgcctatgccataaccatacacaaaagccaaggt
agtggttttgaaaatataatagttgctattcctaaaggattaaacaaatttgtctcaaag
gaaatgctttatacagcagtaacaagggctaaaaaaagattatggataattgttgaagag
agtttagagaatttaattaatgtctataactcggagttaagaaatagaaaaactaattta
tttgacaattttgatattgactctttaattcctttttatgaagagagagctatagaaact
gagagaggagaaaaggttaggagtgaagatgagaagaagttggcagatatttttcataag
ttaggaatagaatatgaatatgagccaatctctgagtatttaaaattgggagttttacca
gactttaaactatgcttaggagataaagaaattctatgggaacattatggcgtggatagc
ttagattatagacttagacagagagagaaagaggaaatttataaaaaagagggatataag
ataatcaaattaggagatatagataatgctaagttagatgagaaagtagttattatctcc
actccagaggatttgaattgtgttgaagagaaaataaaaatattgttagaattagtagaa
atttag

DBGET integrated database retrieval system