KEGG   Methanotorris igneus: Metig_1424Help
Entry
Metig_1424        CDS       T01510                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mig  Methanotorris igneus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metig_1424
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metig_1424
Enzymes [BR:mig01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Metig_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1452874..1453785
Genome map
AA seq 303 aa AA seqDB search
MRHLISMRDIGKEDILRILDEAEKMEEILNSKKPSKILEGKILATIFYEPSTRTRLSFET
AMKRLGGEVIGFGDIENTSVAKGESLIDTIRVVSNYCDIIVLRHPAEGAARLASEYSSVP
IINAGDGSNQHPTQTLLDLYTIKREIGRIDNIRVAFVGDLKYGRTVHSLSYALALFEGVE
LHFISPKELKMPREIIEDLKGRVKIYESDKIDDLDVDVVYVTRIQKERFPDLNEYQKVKG
SYKIKREHVENKDLIVMHPLPRVDEIDYEVDKLPQAKYFKQSFYGIPVRMAILKILIEEF
EKA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatcttatttcaatgagggatattggtaaagaggacattttgagaatattagat
gaagcagagaagatggaggagatattaaattcaaaaaaaccatcaaaaattttagaagga
aagattttagcaacaatattctatgagccatcgacaagaacaaggctatcttttgaaact
gcaatgaagagacttggtggggaagttattggatttggggatattgagaacacttcagta
gcaaagggagaaagtttaatagacaccattagggttgttagtaattattgtgatattatt
gttttaaggcatcctgctgagggagcggcaaggttggcaagcgaatactcatcggtccct
attataaatgcgggagatgggagtaatcagcacccaactcaaacactattggatttatac
acaataaagagagagattggaaggattgataatataagggttgcatttgttggggatttg
aagtatgggaggactgtccattctctttcctatgcactggcactttttgagggtgttgag
ttacactttatttccccaaaagaattgaaaatgccaagggaaatcattgaggatttgaag
gggagagttaagatatatgaatccgataagattgatgatttggatgttgatgttgtttat
gttacaaggatacagaaggagaggttcccagatttgaatgaatatcagaaggttaaagga
agctataagataaagagggagcatgttgaaaataaagatttgattgttatgcacccattg
ccaagggttgatgagattgattacgaagttgataaacttcctcaggcaaaatactttaaa
cagtccttctatggaattccagtaaggatggcaattttgaagattttgattgaagagttt
gaaaaagcataa

DBGET integrated database retrieval system