KEGG   Methanotorris igneus: Metig_1537Help
Entry
Metig_1537        CDS       T01510                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mig  Methanotorris igneus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metig_1537
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metig_1537
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metig_1537
Enzymes [BR:mig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metig_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1576519..1577724
Genome map
AA seq 401 aa AA seqDB search
MKKYKDKYPDKNGKYGIYGGKFVPETLMPAIEELEEAFTRFWINNEGNFREEFEYYLREY
VGRPTPLYYAKRLSELLGCKVYLKREDLAHLGAHKINNAIGQALLAKRMGKTRIIAETGA
GQHGIATAAAATNLGLECVIYMGKKDMERQKLNVFRMELMGAKVVPVVSGSQTLKDAVNE
ALRDWVTNVRNTHYLIGSTLGPHPYPMMVREFQRVIGKEIKQQILEKEGRLPTCILACVG
GGSNSIGAFYEFLDDDVELYAVEAGGKGIETGKHGASLCAGRVGVLHGTKMYVKEDEFGQ
IEESYSISAGLDYPGVSPELSFLKDEERIKAVYVTDDEALEAFQLLCKLEGILPALESSH
AVAYAFKLAEELDKDDIMVINLSGRGDKDVQTVAKALGKIL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtataaggataaatatccggataaaaatggaaaatatggtatttatgggggt
aaatttgtccctgaaaccttaatgccagcaattgaggaattagaagaggcatttacaaga
ttttggataaacaatgagggtaattttagggaagaatttgagtattatttgagagaatat
gttggaagacctacccctctttattatgcgaagagattaagtgagttattgggatgtaaa
gtttatctcaaaagggaagatttagctcacttaggagcacataaaataaacaatgctatt
ggtcaggcattattggctaagagaatggggaaaacaagaattattgccgaaactggtgcg
ggacagcatggaatagcaactgcagcagcggcgacaaatttaggcctggaatgtgtaatt
tatatggggaaaaaggacatggaaaggcagaagttgaatgtttttaggatggaattaatg
ggagcgaaggttgttcctgttgtcagcggttcccaaacattaaaagatgcggtaaatgag
gctttgagagattgggttacaaatgttaggaatactcattatttaattggttctacactc
ggccctcacccatatccaatgatggttagggaattccaaagagtcataggaaaagagatt
aaacagcaaatccttgaaaaagaaggtagattaccaacctgcattttagcatgtgttgga
ggaggaagtaactctattggggcattttatgagtttttagatgatgacgttgagttatat
gcagttgaggccggaggaaaaggaatagaaactggaaaacatggggcatctctatgtgct
ggaagagtgggagttttgcatggaacaaagatgtatgttaaggaggatgagtttggacaa
attgaggaaagttacagtatttctgctggtttagattacccaggagttagcccagaactt
tcattcttaaaggatgaggagagaataaaggcagtatatgttaccgatgatgaggcgttg
gaggcatttcagttgttgtgcaagttagagggtattttgcctgcattggaaagttcccat
gctgttgcttatgcatttaaattagcagaagagttggataaagacgatataatggttata
aacctatctggaagaggagataaggacgtgcagacggttgctaaggcgttaggaaaaata
ttataa

DBGET integrated database retrieval system