KEGG   Methanotorris igneus: Metig_1538Help
Entry
Metig_1538        CDS       T01510                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mig  Methanotorris igneus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metig_1538
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metig_1538
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metig_1538
Enzymes [BR:mig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metig_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1577772..1578626
Genome map
AA seq 284 aa AA seqDB search
MSRLAEKFEELKNKNEKALVAFYVGGDPNLEISKEALEVIANIADIVEIGIPFSDPVADG
PTIQKADVRALNKGMNPLKAFELVKELDEKAPNTPKVFLTYYNIIFNMGEEEFVKRCKEC
GIDGLVVPDLPIEEAESLYNICKKYGVDLIFLVAPTTPDERLKRILEKCSGFVYVVSVTG
ITGVREKVQEETKELVKRVARYSNVPICVGFGISKREHVEEITQYADGAIVGSAIVRIVE
KYLDENGEIKDKEAFLRELEEFVKELKEGTKQKILVKNKVKTKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagtagattagcagagaaatttgaggagttaaaaaataaaaatgaaaaggcattagtc
gcattttacgttggaggagatccaaatttggagatttcaaaagaagcacttgaagttatt
gcaaatatagcggatattgttgaaattggtattccattttcagatccagttgctgatggt
ccaacaattcaaaaggcagatgtaagggcgttaaataaaggaatgaatccattaaaggca
tttgaacttgttaaagagttggatgagaaagctccaaacactccaaaggtgttcttaacc
tattataatataatatttaacatgggagaagaggagtttgtgaaaagatgtaaggaatgt
gggattgatgggttagttgttcctgatttgccaattgaggaggcagaaagtttatacaac
atctgcaaaaaatatggtgttgatttgatatttttggttgctccaacaactccagacgag
aggctaaagagaatcttggaaaaatgtagtgggtttgtttatgttgtttcagtaactgga
attactggagttagggagaaagtccaagaagagacaaaggaactcgtcaaaagagtggca
agatactcaaatgttccaatatgcgttggatttgggatttcaaagagggaacacgttgag
gagataacacaatatgcggatggagcaattgttggtagtgcaatagtaaggattgttgag
aagtatttggatgaaaatggagaaattaaagataaagaggcatttttgagggagttagag
gaatttgttaaagaattaaaagaggggacaaaacaaaaaattttggtgaagaacaaagta
aaaacaaaaaaatga

DBGET integrated database retrieval system