KEGG   Methanotorris igneus: Metig_1634Help
Entry
Metig_1634        CDS       T01510                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mig  Methanotorris igneus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metig_1634
Enzymes [BR:mig01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Metig_1634
Exosome [BR:mig04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metig_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670869..1671843
Genome map
AA seq 324 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETTLTKNDLIMPIFVDENLKSNERKEIQSMPNQYRFSIEGA
VEEAKEIADLGIPAVILFGIPKHKDEVASSAYDKNGVIQKTIKGIKDELGDELLVIADVC
LCEYTSHGHCGIVKDGKILNDETLEILSKIALSYAESGADIVAPSDMMDGRVKAIRETLE
KHGFDDVAIMSYAAKYASSFYGPFRDAAESAPKFGDRKSYQMDIGNAREAMKEIKLDIEE
GADLILVKPALPYLDIIRMARDRFDVPIGGYCVSGEYAMVEAAARNGWLNRESAIFETLL
SIKRAGADFIITYWAKEVASWYLY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctaatcagaccaaggagattgagaaaaaaccaaaaaattagagatttggttagagaa
acaacattaacaaaaaatgatttaataatgccaatatttgtggatgaaaatttgaaaagc
aatgaaaggaaggaaatacaatcaatgcctaaccaatatagattcagcatagagggagct
gttgaagaagcaaaagaaattgctgatttaggtattccagcagttattttgtttggaatc
ccaaaacacaaagatgaagtagcatcatctgcttatgataaaaacggagttatccaaaaa
actataaagggtattaaagatgagttgggggatgaacttttggttattgcagatgtttgc
ttatgcgaatacacatcccacggacattgtggaatcgttaaggatggaaagatattaaat
gacgaaaccttggagattttaagtaaaatagcactttcctatgcagaaagtggggctgat
attgtagctccgtcagatatgatggatgggagggttaaagcaattagggaaaccttagaa
aaacatggatttgatgacgttgctataatgagttatgcggcaaaatatgcatcctctttc
tacggcccatttagggatgcagcagagagtgccccaaaatttggggatagaaaaagttat
caaatggatattggaaatgcaagagaggcgatgaaagagattaagttggacattgaagaa
ggggcggatttaatacttgtaaaaccagcattaccttacttggacataataaggatggca
agggacagatttgatgtgcctattggaggatattgtgttagtggagagtatgcaatggtt
gaagcagcagcaaggaatggatggttgaatagagaaagtgcaatatttgaaacattattg
agtataaaaagggcaggggcagatttcataataacatactgggcaaaggaagtggcatca
tggtatttatattaa

DBGET integrated database retrieval system