KEGG   Methanotorris igneus: Metig_1650Help
Entry
Metig_1650        CDS       T01510                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mig  Methanotorris igneus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metig_1650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metig_1650
   00640 Propanoate metabolism
    Metig_1650
   00660 C5-Branched dibasic acid metabolism
    Metig_1650
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metig_1650
Enzymes [BR:mig01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metig_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690553..1691656
Genome map
AA seq 367 aa AA seqDB search
MKLHEYEAKNIFKEYGIPIPEGFIISKEEISKIDDIGINKPVVVKAQVLVGGRGKAGGIL
FADNKEELKEKINELFSKEIKGEEVEKVLIEEKLPIKKEYYLGIVIDRTEKRPAIMFSTE
GGVDIEEVAKRNPEKIVKYHIEPRKEFLPYSARWILKHAGIPSKEIPIVADVMYKLYKVF
KEMDAVLAEINPLVITEDGKVYAADAVLNVDDDAYYRHDYSKFEEFGKKEKLEFAYVELD
GDIGVIGNGAGLTLASMDIIKEFGGNPACFLDIGGGASAEIVKKALKKVLENPKVRGVFI
NILGGITRCDEVAKGIVEILKEHPNVKFAVRMMGTNEEEGRKILEENGIPYETSMEEAAR
KLMENLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatgaatatgaagcaaaaaacatatttaaggaatatggaattccaattcca
gaaggttttattatttcaaaggaagaaatttcaaagatagatgacatcgggattaataag
cctgttgtagttaaagctcaggttttagttggtggaagaggaaaagcaggaggaatttta
tttgcagataataaagaggagttaaaagagaagattaatgaactttttagcaaagagata
aaaggagaggaagttgagaaggtattaattgaggagaaattgccaataaaaaaggaatac
tacttgggaattgttattgatagaactgaaaaaaggccagctattatgttttcaactgag
ggtggagtagatattgaagaagtagcaaaaagaaaccctgaaaagatcgtaaaataccac
atagaaccaagaaaagagttccttccatactctgcaaggtggattttgaaacatgcaggt
attccatcaaaagaaatccctatagttgctgatgttatgtataagttatataaagtattc
aaagaaatggatgccgtattggctgagataaaccctcttgttataacagaggatggaaag
gtttatgctgctgacgctgttttgaatgtcgatgatgatgcttattataggcatgattac
tcaaagtttgaagaatttggtaaaaaggagaaattagaatttgcctatgttgagttggat
ggggacattggggttattggaaatggagcaggtttgacgttggcaagtatggacattatt
aaagaatttggtggaaatccagcatgtttcttagatattggcggtggagcaagtgcagag
attgttaaaaaggcattgaaaaaggttttagaaaatccaaaggttaggggagtttttata
aatatacttggtggaataacaaggtgtgatgaggttgcaaagggaattgttgagatttta
aaagagcatcctaatgtaaaatttgccgttagaatgatgggaactaatgaagaagaggga
aggaaaattttagaggaaaatggcattccttacgaaacttcaatggaagaggcagcaaga
aaattaatggagaatttggcataa

DBGET integrated database retrieval system