KEGG   Methanotorris igneus: Metig_1650Help
Entry
Metig_1650        CDS       T01510                                 

Definition
succinyl-CoA ligase (ADP-forming) subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mig  Methanotorris igneus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metig_1650
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metig_1650
   00640 Propanoate metabolism
    Metig_1650
   00660 C5-Branched dibasic acid metabolism
    Metig_1650
Enzymes [BR:mig01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metig_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690553..1691656
Genome map
AA seq 367 aa AA seqDB search
MKLHEYEAKNIFKEYGIPIPEGFIISKEEISKIDDIGINKPVVVKAQVLVGGRGKAGGIL
FADNKEELKEKINELFSKEIKGEEVEKVLIEEKLPIKKEYYLGIVIDRTEKRPAIMFSTE
GGVDIEEVAKRNPEKIVKYHIEPRKEFLPYSARWILKHAGIPSKEIPIVADVMYKLYKVF
KEMDAVLAEINPLVITEDGKVYAADAVLNVDDDAYYRHDYSKFEEFGKKEKLEFAYVELD
GDIGVIGNGAGLTLASMDIIKEFGGNPACFLDIGGGASAEIVKKALKKVLENPKVRGVFI
NILGGITRCDEVAKGIVEILKEHPNVKFAVRMMGTNEEEGRKILEENGIPYETSMEEAAR
KLMENLA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatgaatatgaagcaaaaaacatatttaaggaatatggaattccaattcca
gaaggttttattatttcaaaggaagaaatttcaaagatagatgacatcgggattaataag
cctgttgtagttaaagctcaggttttagttggtggaagaggaaaagcaggaggaatttta
tttgcagataataaagaggagttaaaagagaagattaatgaactttttagcaaagagata
aaaggagaggaagttgagaaggtattaattgaggagaaattgccaataaaaaaggaatac
tacttgggaattgttattgatagaactgaaaaaaggccagctattatgttttcaactgag
ggtggagtagatattgaagaagtagcaaaaagaaaccctgaaaagatcgtaaaataccac
atagaaccaagaaaagagttccttccatactctgcaaggtggattttgaaacatgcaggt
attccatcaaaagaaatccctatagttgctgatgttatgtataagttatataaagtattc
aaagaaatggatgccgtattggctgagataaaccctcttgttataacagaggatggaaag
gtttatgctgctgacgctgttttgaatgtcgatgatgatgcttattataggcatgattac
tcaaagtttgaagaatttggtaaaaaggagaaattagaatttgcctatgttgagttggat
ggggacattggggttattggaaatggagcaggtttgacgttggcaagtatggacattatt
aaagaatttggtggaaatccagcatgtttcttagatattggcggtggagcaagtgcagag
attgttaaaaaggcattgaaaaaggttttagaaaatccaaaggttaggggagtttttata
aatatacttggtggaataacaaggtgtgatgaggttgcaaagggaattgttgagatttta
aaagagcatcctaatgtaaaatttgccgttagaatgatgggaactaatgaagaagaggga
aggaaaattttagaggaaaatggcattccttacgaaacttcaatggaagaggcagcaaga
aaattaatggagaatttggcataa

DBGET integrated database retrieval system