KEGG   Methanotorris igneus: Metig_1691Help
Entry
Metig_1691        CDS       T01510                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mig  Methanotorris igneus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Metig_1691
Enzymes [BR:mig01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Metig_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735199..1736044
Genome map
AA seq 281 aa AA seqDB search
MEYFEDYTKFICASDDFENADAVIFGIPYDGTTSFKAGTRFGPKAIREASWGLETYSPIL
RKDLVDCNFCDMQDIFIYGSQEETFERIYQASKDIMKSEKIPIMLGGEHSVTYPVVKAAK
DIYGDLVVLHFDAHCDLRDEYLGNKLSHACVIRRCYELTKDIYQFGIRSGDREEWEFAKN
TKLSMELMSKEDVKEIKDLDKPIYLTVDIDVLDPAFAPGTGTPEPCGFSTRELLNSLYNL
KEVNDRIIGFDVVEVSPHYDIGGITAIAAAKIVRELILMIL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggaatattttgaggattatacaaagtttatatgtgcaagtgatgactttgaaaatgca
gatgcagttatttttggaatcccgtacgatggaactacaagttttaaagcagggacaaga
ttcggtcctaaggcaataagagaggcgtcatggggattggaaacatacagcccaatttta
aggaaggatttggttgattgcaatttttgcgatatgcaggacatttttatttatggaagt
caggaagaaacatttgagaggatatatcaagcctcaaaagacataatgaagagcgaaaaa
attccaataatgcttggaggagaacactcagtaacctaccctgttgttaaggcagcgaag
gatatctatggagatttggtggtcttgcactttgatgcccattgtgatttgagggatgag
tatttggggaacaagttgtcccatgcatgtgttattaggagatgctatgaattaacaaaa
gacatctaccaatttgggattaggagtggggatagagaggagtgggaatttgcaaaaaat
acaaaattatccatggagttaatgagtaaggaagatgtaaaagaaattaaggatttagat
aaaccaatatatttaactgttgatattgacgttttagaccctgcatttgcccctggaaca
ggaacaccagaaccttgtggattttcaacaagagagttattgaattccctatataattta
aaagaagttaacgataggattattggttttgatgttgttgaggtatctccgcattatgat
attggagggattactgctattgcagcggcaaagattgttagggaattaattttgatgata
ttgtaa

DBGET integrated database retrieval system