KEGG   Micromonospora sp. L5: ML5_0491Help
Entry
ML5_0491          CDS       T01379                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mil  Micromonospora sp. L5
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_0491
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML5_0491
   00640 Propanoate metabolism
    ML5_0491
   00660 C5-Branched dibasic acid metabolism
    ML5_0491
Enzymes [BR:mil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ML5_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(501272..502450)
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVKAQVKVGGRGKAGGVK
LAEGAEETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVA
GGMDIEQVAAETPERVVKAPIDANTGVDEAKAREIVTAAGFPAEIADQVVEVAVKLWQAF
VAEDATLVEVNPLATTKDGKLLLLDAKVTLDENAGFRHPDHEALVDQASVDPLEQAAKAK
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAEVMANGLE
IVLSDPSVKSVFVNVFGGITACDAVANGIVQALALLEQRGEKATKPLVVRLDGNNAEAGR
AILDGAANPLIQRVDTMDGAAERAAELAAAGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggggcgggacctgttcgagcggcacggcttgcccgtgctc
gccggcggcgtcgccactaccccggaggaggcccgcgcgatcgccgaacgcctcggcggc
cgggtggtcgtcaaggcgcaggtgaaggtcggtggccgcggcaaggccggcggcgtgaag
ctggccgagggcgcggaggagacggtggctcgggccaccgacatcctcggcatggacatc
aagggtcacaccgtccacaaggtcatgatcaccgtgaccgcggacgtggccgaggagtac
tacttctcgtacctgctcgaccgggcgaaccgcaccttcctctgcatcgccagcgtggcc
ggcggtatggacatcgagcaggtcgcggccgagaccccggagcgggtcgtgaaggcgccg
atcgacgccaacaccggcgtggacgaggccaaggcgcgcgagatcgtcaccgcggccggc
ttcccggccgagatcgccgaccaggtggtcgaggtcgcggtcaagctgtggcaggcgttc
gtggccgaggacgccacgctcgtcgaggtgaacccgctggccacgaccaaggacggcaag
ctgctgctcctggacgccaaggtcaccctggacgagaacgccgggttccggcacccggac
cacgaggccctggtcgaccaggcgtcggtggacccgctggagcaggccgcgaaggccaag
gacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtccacgctcgacgtggtcgcgtacgcgggcgagcggcacggcggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcgagcgccgaggtgatggcgaacggcctggag
atcgtcctgtccgacccgtcggtcaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcctgtgacgcggtcgccaacggcatcgtgcaggcgctggcgctgctggagcagcgcggc
gagaaggccaccaagccgctcgtcgtgcgcctcgacggcaacaacgccgaggccggccgg
gcgatcctcgacggcgcggccaacccgctgatccagcgggtcgacaccatggacggcgcg
gccgagcgggccgccgagctggcagctgcgggggtctga

DBGET integrated database retrieval system