KEGG   Micromonospora sp. L5: ML5_0491Help
Entry
ML5_0491          CDS       T01379                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mil  Micromonospora sp. L5
Pathway
mil00020  Citrate cycle (TCA cycle)
mil00640  Propanoate metabolism
mil00660  C5-Branched dibasic acid metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01200  Carbon metabolism
Module
mil_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mil_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML5_0491
   00640 Propanoate metabolism
    ML5_0491
   00660 C5-Branched dibasic acid metabolism
    ML5_0491
Enzymes [BR:mil01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ML5_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ADU06041
JGI: ML5_0491
Position
complement(501272..502450)
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVKAQVKVGGRGKAGGVK
LAEGAEETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVA
GGMDIEQVAAETPERVVKAPIDANTGVDEAKAREIVTAAGFPAEIADQVVEVAVKLWQAF
VAEDATLVEVNPLATTKDGKLLLLDAKVTLDENAGFRHPDHEALVDQASVDPLEQAAKAK
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGGVKPANFLDIGGGASAEVMANGLE
IVLSDPSVKSVFVNVFGGITACDAVANGIVQALALLEQRGEKATKPLVVRLDGNNAEAGR
AILDGAANPLIQRVDTMDGAAERAAELAAAGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgagtaccaggggcgggacctgttcgagcggcacggcttgcccgtgctc
gccggcggcgtcgccactaccccggaggaggcccgcgcgatcgccgaacgcctcggcggc
cgggtggtcgtcaaggcgcaggtgaaggtcggtggccgcggcaaggccggcggcgtgaag
ctggccgagggcgcggaggagacggtggctcgggccaccgacatcctcggcatggacatc
aagggtcacaccgtccacaaggtcatgatcaccgtgaccgcggacgtggccgaggagtac
tacttctcgtacctgctcgaccgggcgaaccgcaccttcctctgcatcgccagcgtggcc
ggcggtatggacatcgagcaggtcgcggccgagaccccggagcgggtcgtgaaggcgccg
atcgacgccaacaccggcgtggacgaggccaaggcgcgcgagatcgtcaccgcggccggc
ttcccggccgagatcgccgaccaggtggtcgaggtcgcggtcaagctgtggcaggcgttc
gtggccgaggacgccacgctcgtcgaggtgaacccgctggccacgaccaaggacggcaag
ctgctgctcctggacgccaaggtcaccctggacgagaacgccgggttccggcacccggac
cacgaggccctggtcgaccaggcgtcggtggacccgctggagcaggccgcgaaggccaag
gacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtccacgctcgacgtggtcgcgtacgcgggcgagcggcacggcggcgtcaagccg
gccaacttcctcgacatcggcggcggcgcgagcgccgaggtgatggcgaacggcctggag
atcgtcctgtccgacccgtcggtcaagagcgtcttcgtcaacgtcttcggcggcatcacc
gcctgtgacgcggtcgccaacggcatcgtgcaggcgctggcgctgctggagcagcgcggc
gagaaggccaccaagccgctcgtcgtgcgcctcgacggcaacaacgccgaggccggccgg
gcgatcctcgacggcgcggccaacccgctgatccagcgggtcgacaccatggacggcgcg
gccgagcgggccgccgagctggcagctgcgggggtctga

DBGET integrated database retrieval system