KEGG   Micromonospora sp. L5: ML5_0815Help
Entry
ML5_0815          CDS       T01379                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mil  Micromonospora sp. L5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mil00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
820893..822278
Genome map
AA seq 461 aa AA seqDB search
MAIRSSRRRSAAISVAAVAGLAAAGVGFAVGGASAGTVSGSLYRDPSSAVVRWVAANPGD
SRAAVIRDKIASQPQARWYANFNPSTIQSEVSSFIGAANAAQQIPVLSVYEITNRDCGGA
SAGGAPDLNQYQTWVSNFARGLGNQTVLIILETDSLALQTCLSTGELNARNQALTTATQT
IKSANPNAKVYLDGGHSTWNSANDTANRLRAAGVQYADGFFTNVSNFNPTSSEANFGRAV
ISALNGMGISGKRQVIDTSRNGGAAGDWCADDNTDRRIGQYPTTNTGDANIDAYLWVKPP
GEADGCRYTAGSFQPDLAFSLANGAPNPPTTAPPTTNPPTTAPPTTAPPTTAPPTTAPPT
TPPPAGNGCSAAVAINQWNGGFTASVNVTAGSAAINGWTVTVALPGGAAITGTWNAQASG
TSGTVRFTNVGYNGQVGAGQTTNFGFQGTGTGQGATATCAA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtggctatccgctcgtcccgccgcagatcagcggccatcagcgtggccgccgtcgcgggc
ctcgccgcggccggcgtcggtttcgccgtcggtggcgcatccgccggcacggtgtccgga
tcgctctaccgcgacccgtcctcggcggtcgtccgctgggtcgccgccaaccccggcgac
tcgcgcgccgccgtcatccgcgacaagatcgccagccagccgcaggcgcgctggtacgcc
aacttcaacccgtcgaccatccagtccgaggtctccagcttcatcggcgccgccaacgcg
gcgcagcagatcccggtgctgtcggtgtacgagatcaccaaccgggactgcggcggcgcc
agcgccggcggggcgccggacctcaaccagtaccagacctgggtgtccaacttcgcccgc
ggactcggcaaccagaccgtcctgatcatcctggagaccgactcgctcgcgctccagacc
tgcctgagcaccggcgagctgaacgcccgcaaccaggcgctcaccacggcgacccagacc
atcaagtcggccaaccccaacgccaaggtgtacctcgacggcggccactcgacctggaac
agcgccaacgacactgccaaccggctccgcgcggccggcgtgcagtacgccgacggcttc
ttcaccaacgtgtcgaacttcaaccccacctccagtgaggcgaacttcggccgggccgtc
atctccgcgctcaacggcatgggcatctccggcaagcggcaggtcatcgacaccagccgc
aacgggggagccgccggggactggtgcgccgacgacaacaccgaccggcgcatcgggcag
tacccgacgacgaacaccggcgacgccaacatcgacgcgtacctctgggtgaagcccccg
ggtgaggcggacggctgccgctacacggccggttcgttccagccggacctggccttcagc
ctcgcgaatggcgcgccgaacccgccgaccaccgcgccgccgacgaccaacccgccgacg
accgcaccgccgaccacggctccgccgacgaccgcgccgcccaccacggcgccgccgacc
accccgccgccggccggtaacggctgctccgcggcggtcgcgatcaaccagtggaacggc
ggcttcaccgcgagcgtgaacgtcaccgcgggctccgcggccatcaacggctggaccgtg
accgtcgcgctgcccggcggcgccgcgatcaccggcacctggaacgcccaggccagcggc
accagcggcaccgtccggttcacgaatgtgggctacaacgggcaggtcggcgccggccag
accaccaacttcggcttccagggcaccggcaccggccagggcgccaccgccacctgcgcc
gcctga

DBGET integrated database retrieval system