KEGG   Micromonospora sp. L5: ML5_0989Help
Entry
ML5_0989          CDS       T01379                                 

Definition
4-diphosphocytidyl-2c-methyl-d-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mil  Micromonospora sp. L5
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mil00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
977127..978080
Genome map
AA seq 317 aa AA seqDB search
MTEAWRPGDEDGQRRGAGGPVKVRVPAKVNLHLGVGPLRRDGYHELNTVYHAISIYDELT
ARRGDTLTLTMEGEGAGELALDDTNLALRAAHALAGYAGVAPHARLHLRKQIPLAGGLAG
GSADAAAALVACDTLWGTGLSRDELAGIAADLGSDVPFLIHGGTALGTGRGEAVSPVLAR
PTSWHWVVAIADAGLSTPAAYRELDRLRDAGAAGTPLGSTDALLAALRQRDPRVLAATLG
NDLQDAALTMRPSLAETLKAGEAAGALAGIVSGSGPTCVFLATGEADAVRIAAEITAAGV
CREARVAHGPVAGARVV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggcatggcgaccgggggacgaggacgggcagcggcgcggcgccggcggcccg
gtcaaggtgcgggtgcccgccaaggtcaacctgcatctcggggtcggaccgctgcggcgt
gacggctaccacgagctgaacaccgtctaccacgcgatctcgatctacgacgagctgacc
gcccgtcgcggcgacacgctcaccctcaccatggagggcgagggcgccggcgagctggcg
ctggacgacaccaacctggcgctgcgcgccgcgcacgcgctggccggttacgcgggcgtc
gccccgcacgcccggctgcacctgcgcaagcagatcccgctcgccggcgggctggccggt
ggcagcgccgacgccgccgccgcgctcgtcgcctgcgacacgctctggggcaccgggctg
tcccgcgacgagctcgccggcatcgccgccgacctcggctcggacgtgccgttcctcatc
cacggcggcaccgcgctcggcaccggccgcggcgaggcggtcagcccggtgctggcccgc
cccacctcctggcactgggtggtggcgatcgccgacgccggcctgtccaccccggccgcg
taccgggaactggaccggctgcgtgacgccggagccgccggcacgccgctgggcagcacc
gacgcgctgctcgccgcgctgcgccagcgcgatccgcgggtgctcgccgccacgctcggc
aacgacctccaggacgccgcgctgaccatgcgcccctcgctggccgagacgctcaaggcc
ggcgaggccgcgggggcgctcgccggcatcgtctccggctccggacccacctgcgtcttc
ctcgccaccggcgaggccgacgccgtccggatcgccgccgagatcaccgccgccggggtg
tgccgggaggcccgcgtcgcgcacggtccggtcgccggcgcccgcgtggtctga

DBGET integrated database retrieval system