KEGG   Micromonospora sp. L5: ML5_0999Help
Entry
ML5_0999          CDS       T01379                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mil  Micromonospora sp. L5
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ML5_0999
Enzymes [BR:mil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ML5_0999
Transfer RNA biogenesis [BR:mil03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ML5_0999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
987209..988042
Genome map
AA seq 277 aa AA seqDB search
MGSPPMIDGGFARWLASRAGQALTALRAEMGFADAGALRSAGDKVSHDLIRTELAKWRPA
DAVLSEEDEGSRLAWTAEVTDAALSRLTADRVWIIDPLDGTREYAEEGRADWAVHVALWS
RNASRPYGLVAGAVALPAQHRVLGTDHPPAYPPMTVEAATGGGARVIRLAASRSRPPVFL
TDLAEDVGAHLVPMGSAGAKIAAVVTGEIDAYIHAGGQYEWDSAAPVAVSTATGLHASRI
DGSALKYNGADPRLPDLLVCRKDLASRLLAALQRHSG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtcctccgatgatcgacggcgggttcgcccggtggctggcgtcccgggccggt
caggcgctgacggccctgcgcgcggagatgggcttcgccgacgcgggcgcgctccggtcg
gccggcgacaaggtctcgcacgatctgatccgcaccgagctggcgaagtggcggccggcg
gacgcggtgctgtcggaggaggacgagggctcgcggctggcctggacggcggaggtgaca
gacgcggcgctttcgcgcctgaccgcggaccgggtctggatcatcgacccgctggacggc
acccgggagtacgcggaggaggggcgcgcggactgggcggtgcacgtggcgctctggtcg
cgtaacgcgtcgcggccgtacggtctggtggcgggcgcggtggcgctgccggcccagcac
cgggtgctcggcacggaccacccgccggcgtacccgccgatgacagtggaggcggccacc
gggggcggcgcgcgggtcatccgcttggcggccagccgtagccgtccgccggttttcctg
accgacctggcagaggacgtcggcgctcatctggttccgatgggctcggcgggcgcgaag
atcgccgccgtggtcacgggtgagatcgacgcgtacatccacgcgggcggtcagtacgag
tgggattcggccgctccggtcgctgtgtcgacggccaccggtctgcatgcttcccggatc
gacggttctgcgctgaaatacaacggggccgacccgcgcctaccggatctgctggtctgc
cgcaaggatctcgcgagtcggttgcttgcagcgttgcagcggcattccgggtaa

DBGET integrated database retrieval system