KEGG   Micromonospora sp. L5: ML5_1022Help
Entry
ML5_1022          CDS       T01379                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mil  Micromonospora sp. L5
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ML5_1022
Enzymes [BR:mil01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ML5_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1013602..1014882
Genome map
AA seq 426 aa AA seqDB search
MSAFTAVDVIRAKRDGGVLSDGQIDWVVDAYTKGLVADEQMSALAMAILLRGMTAPEIAR
WTAAMIASGERLDLSPVSRPTVDKHSTGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIPGWRAALTNDEFIAQLRDVGAVICAAGDGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKNVDDARELARTMVELGGAHGVRTVALLT
DMSTPLGLAVGNAVEVTESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPEAALRDG
RAMDSWRTMIRAQGGDPDAPMPTANEVELVTATEDGWVADIDAYAIGVAAWRLGAGRARK
EDPVSIPAGVVLHKRRGDRVRVGDPLFELRAEHAERMPAALDEARRAVRVAPDAPDATPL
VVERIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcttttacggcggttgacgtcatccgggcgaagcgggacgggggtgtgctgagc
gacgggcagatcgactgggtggtcgacgcgtacaccaagggtctggtcgccgacgagcag
atgtcggcgctggccatggcgatcctgctgcgcggcatgaccgccccggagatcgcccgg
tggaccgccgccatgatcgccagcggcgagcggctcgacctgtcgccggtgtcccggccg
acggtggacaagcactccaccggcggcgtcggcgacaagatcaccctgccgctgaccccg
ctggtggccgcgtgcggcgcggcggtgccgcagctgtccggccggggcctgggccacacc
ggcggcacgctggacaagctggagtcgatcccgggctggcgggcggcgctgaccaacgac
gagttcatcgcccagctccgcgacgtgggcgcggttatctgcgcggccggcgacgggctc
gccccggccgaccgcaagctgtacgcgttgcgcgacgtcaccggcaccgtcgaggcgatc
ccgctgatcgccagctcgatcatgagcaagaagatcgccgaggggaccggcgcgctggtg
ctcgacgtgaaggtcggctccggcgcgttcatgaagaacgtcgacgacgcccgcgagctg
gcccgcaccatggtcgagctgggcggcgcgcacggcgtacggacggtcgccctgctcacc
gacatgtccactccgctcggcctcgcagtgggcaacgcggtcgaggtgaccgagtcggtg
gaggtgctcgccggtggcggtccggccgacgtggtggagctgacgctggcactggcccgg
gagatgctcgacgcggccgggctgccggacgccgacccggaggcggcactgcgggacggc
cgggcgatggactcctggcgcacgatgatccgggcgcagggcggtgacccggacgccccg
atgcccaccgcgaacgaggtcgagctggtcaccgccaccgaggacggctgggtcgccgac
atcgacgcgtacgcgatcggggtggccgcgtggcgtctcggcgcgggccgggcccgcaag
gaggacccggtgagcatcccggccggcgtggtgctgcacaagcgccgcggtgaccgggtg
cgtgtcggcgacccgctgttcgagctgcgggccgagcacgccgagcggatgcccgccgcg
ctggacgaggcgcgccgcgcggtgcgggtggcgccggacgcgccggacgcgacgcctctg
gtcgtcgagcggatcggctga

DBGET integrated database retrieval system