KEGG   Micromonospora sp. L5: ML5_1051Help
Entry
ML5_1051          CDS       T01379                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain i
Orthology
K01840  
phosphomannomutase [EC:5.4.2.8]
Organism
mil  Micromonospora sp. L5
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ML5_1051
   00520 Amino sugar and nucleotide sugar metabolism
    ML5_1051
Enzymes [BR:mil01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     ML5_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1045011..1046675)
Genome map
AA seq 554 aa AA seqDB search
MAAETTDLDDLRVRAERWLADDPDPDDRVELRTVLDGLPGTAADLADRFAGPLTFGTAGL
RGPLRAGPNGMNLAVVTQAAAGLVGWLAAQGGEGPLVIGYDARRGSRAFAERTAQVATGA
GRPALLLPRPLPTPVLAFAVRQLGAVAGVMVTASHNPPQDNGYKVYLGAQLGGELGAGAQ
IVPPADAGIEAAIRAVGPLAAVPLGPAGQVLGDDMVTAYVEQAAAVVDPAGPRDLKVAYT
PLHGVGGVVLTAAFARAGFGVPGVVPEQAEPDPAFPTVSFPNPEEPGAVDLLVALADRTG
ADLAVANDPDADRCAVAVRDAGSWRMLRGDEVGALLADHLMRRGVTGLYATTIVSSALLR
AMAAARGLPYDETLTGFKWIVRAGGGREPLVYGYEEALGYCVAPGHVRDKDGITAALTVA
ELAAGLKAEGRTLLDRLDELAAEFGVHHTEQLSVRVEDLRVIADSMARIRAATPTTLLGQ
PVTEASDLLPDADVVILRTGAARVVIRPSGTEPKLKAYLEVVEPVTGGDVPAARQRARAA
VTELRNEIADALGL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaaccactgaccttgacgaccttcgcgtacgcgccgagcgctggctcgcc
gacgacccggacccggacgaccgcgtcgagctgcgcacggtcctcgacgggctgcccggc
acggcggccgacctggccgaccggttcgccggcccgctgaccttcggcaccgccgggctg
cgcggcccgctgcgggccgggccgaacggcatgaacctcgccgtggtcacccaggccgcc
gccgggctcgtcggctggctcgccgcccagggcggcgagggcccgctggtgatcgggtac
gacgcccggcgcggctcccgtgccttcgccgagcgcaccgcacaggtggccaccggtgct
ggccgcccggcgctgctgctgccccggccgctgcccacgcccgtgctggcgttcgcggtc
cggcagctcggcgcggtcgccggggtgatggtcacggccagccacaacccgccgcaggac
aacggctacaaggtctacctgggcgcgcagctcggcggtgagctcggcgccggcgcgcag
atcgtgccgcccgccgacgccggcatcgaggcggccatccgggcggtcggcccgctcgcg
gcggtgccgctcggcccggccggtcaggtgctcggcgacgacatggtgaccgcgtacgtg
gagcaggccgccgcggtggtggacccggccggaccgcgggacctgaaggtggcgtacacg
ccgctgcacggggttggtggcgtggtgctgaccgccgcgttcgcgcgcgccggtttcggc
gttccaggcgtggtgcccgagcaggccgagccggacccggcgttcccgaccgtgagcttc
cccaacccggaggagccgggcgcggtggacctgctcgtcgcgctcgccgaccgcaccggc
gccgacctcgccgtcgccaacgacccggacgcggaccgctgcgcggtggccgtacgcgac
gccgggtcctggcggatgctgcgcggcgacgaggtgggcgcgctgctcgccgaccacctg
atgcggcgcggcgtgaccggcctgtacgccaccacgatcgtgtcgtcggcgctgctgcgg
gccatggcggcggcccggggcctgccctacgacgagacgctcaccgggttcaagtggatc
gtgcgggccggcgggggccgggagccgctggtgtacggctacgaggaggcgctgggctac
tgcgtcgcgccgggtcacgtccgggacaaggacggcatcaccgccgcgctgacggtcgcc
gagctggccgccggtctcaaggccgagggccgtacgctcctcgaccggctggacgagctg
gccgccgagttcggcgtgcaccacaccgagcagctctcggtccgggtggaggacctgcgg
gtgatcgcggactcgatggcccggatccgggcggccaccccgaccacgctgctcgggcag
ccggtgaccgaggcgtccgacctgctccccgacgcggacgtggtgatcctgcgcaccggc
gcggcccgggtggtgatccggccgtcgggcaccgagccgaagctcaaggcgtacctggag
gtggtggagccggtgaccggcggcgacgtgcccgcggcccggcagcgcgcgcgggccgcc
gtcacggagctgcgcaacgagatcgccgacgccctgggcctctga

DBGET integrated database retrieval system