KEGG   Micromonospora sp. L5: ML5_1230Help
Entry
ML5_1230          CDS       T01379                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mil  Micromonospora sp. L5
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML5_1230
   00650 Butanoate metabolism
    ML5_1230
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ML5_1230
   00280 Valine, leucine and isoleucine degradation
    ML5_1230
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML5_1230
Enzymes [BR:mil01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ML5_1230
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ML5_1230
Amino acid related enzymes [BR:mil01007]
 Aminotransferase (transaminase)
  Class III
   ML5_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1237760..1239031)
Genome map
AA seq 423 aa AA seqDB search
MATSEELHKRRVEAVARGVGSTIPAYVDRAGGGTITDVDGREWIDFAAGIAVTNVGNSAP
RVVEAVRAQVERFTHTCFMVAPYESYVAVCEQLNALTPGGFEKRSALFNSGAEAVENAVK
IARHATGRPAVVVFDHAYHGRTNLTMALTAKNMPYKHRFGPFAGEVYRVPMSYPLRDGGL
DGATAAARSIEMIEKQVGAENVAALLIEPIQGEGGFVVPAQGFLPALREWATAAGVVFVA
DEIQTGFCRTGDWFACEHEGVQPDLITLAKGIAGGLPLAAVTGRADLMDAVHVGGLGGTY
GGNPIACAAALASMETMRELDLGAAARRIGAVMGERLRVIAAGDPRVAEVRGRGAMLAME
IVVPGTLTPDPAATAAISAACHAAGLLTLTCGTYSNVLRFLPPLVISDDELGRGLDILAA
AFG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccacgagcgaggagctgcacaagcgccgggtcgaggcggtggcgcggggcgtgggc
agcacgatccccgcgtacgtggaccgggcgggcggcggcacgatcaccgacgtggacggc
cgcgagtggatcgacttcgcggccggcatcgctgtcaccaacgtgggcaactccgcgccg
cgcgtggtcgaggcggtacgcgcgcaggtcgaacgcttcacccacacctgcttcatggtc
gcgccgtacgagtcgtacgtggcggtctgcgagcagctcaacgcgctgacgccgggtggc
ttcgagaagcggtcggcgttgttcaactccggcgccgaggcggtggagaacgcggtgaag
atcgcccggcacgcgaccgggcggcccgctgtcgtggtgttcgaccacgcgtaccacggc
cggaccaacctgacgatggcgctgaccgcgaagaacatgccgtacaagcaccggttcggg
ccgttcgccggtgaggtctaccgggtgccgatgtcgtacccgctgcgcgacggcgggctg
gacggcgccaccgcggcggcccggtcgatcgagatgatcgagaagcaggtgggcgcggag
aacgtggcggcgctgctgatcgagccgatccagggcgagggcggtttcgtcgtacccgct
cagggtttcctgccggcgctgcgcgagtgggcgacggcggccggggtggtgttcgtcgcc
gacgagatccagaccggtttctgccgcaccggcgactggttcgcctgcgagcacgagggc
gtgcagccggacctgatcacgctggcgaagggcatcgcgggcggcctgccgctggcggcg
gtgaccggccgggcggacctgatggacgcggtgcacgtcggcggcctcggcggcacgtac
ggcggaaacccgatcgcctgcgccgccgcgctcgcgtcgatggagacgatgcgggagctg
gacctgggcgccgccgcgcgccggatcggcgcggtgatgggtgagcggctgcgcgtgatc
gccgccggtgacccgcgcgtggccgaggtacgcggccggggcgcgatgctcgcgatggag
atcgtggtgccgggcacgctgaccccggacccggccgccacggcggcgatctcggcggcc
tgccacgcggccgggctgctcaccctgacctgcggcacctacagcaacgtgctgcggttc
ctgcctccgctcgtcatctccgacgacgagctgggccggggactggacatcctggcggcc
gccttcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system