KEGG   Micromonospora sp. L5: ML5_1230Help
Entry
ML5_1230          CDS       T01379                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mil  Micromonospora sp. L5
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mil00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mil00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mil00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mil00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mil00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1237760..1239031)
Genome map
AA seq 423 aa AA seqDB search
MATSEELHKRRVEAVARGVGSTIPAYVDRAGGGTITDVDGREWIDFAAGIAVTNVGNSAP
RVVEAVRAQVERFTHTCFMVAPYESYVAVCEQLNALTPGGFEKRSALFNSGAEAVENAVK
IARHATGRPAVVVFDHAYHGRTNLTMALTAKNMPYKHRFGPFAGEVYRVPMSYPLRDGGL
DGATAAARSIEMIEKQVGAENVAALLIEPIQGEGGFVVPAQGFLPALREWATAAGVVFVA
DEIQTGFCRTGDWFACEHEGVQPDLITLAKGIAGGLPLAAVTGRADLMDAVHVGGLGGTY
GGNPIACAAALASMETMRELDLGAAARRIGAVMGERLRVIAAGDPRVAEVRGRGAMLAME
IVVPGTLTPDPAATAAISAACHAAGLLTLTCGTYSNVLRFLPPLVISDDELGRGLDILAA
AFG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccacgagcgaggagctgcacaagcgccgggtcgaggcggtggcgcggggcgtgggc
agcacgatccccgcgtacgtggaccgggcgggcggcggcacgatcaccgacgtggacggc
cgcgagtggatcgacttcgcggccggcatcgctgtcaccaacgtgggcaactccgcgccg
cgcgtggtcgaggcggtacgcgcgcaggtcgaacgcttcacccacacctgcttcatggtc
gcgccgtacgagtcgtacgtggcggtctgcgagcagctcaacgcgctgacgccgggtggc
ttcgagaagcggtcggcgttgttcaactccggcgccgaggcggtggagaacgcggtgaag
atcgcccggcacgcgaccgggcggcccgctgtcgtggtgttcgaccacgcgtaccacggc
cggaccaacctgacgatggcgctgaccgcgaagaacatgccgtacaagcaccggttcggg
ccgttcgccggtgaggtctaccgggtgccgatgtcgtacccgctgcgcgacggcgggctg
gacggcgccaccgcggcggcccggtcgatcgagatgatcgagaagcaggtgggcgcggag
aacgtggcggcgctgctgatcgagccgatccagggcgagggcggtttcgtcgtacccgct
cagggtttcctgccggcgctgcgcgagtgggcgacggcggccggggtggtgttcgtcgcc
gacgagatccagaccggtttctgccgcaccggcgactggttcgcctgcgagcacgagggc
gtgcagccggacctgatcacgctggcgaagggcatcgcgggcggcctgccgctggcggcg
gtgaccggccgggcggacctgatggacgcggtgcacgtcggcggcctcggcggcacgtac
ggcggaaacccgatcgcctgcgccgccgcgctcgcgtcgatggagacgatgcgggagctg
gacctgggcgccgccgcgcgccggatcggcgcggtgatgggtgagcggctgcgcgtgatc
gccgccggtgacccgcgcgtggccgaggtacgcggccggggcgcgatgctcgcgatggag
atcgtggtgccgggcacgctgaccccggacccggccgccacggcggcgatctcggcggcc
tgccacgcggccgggctgctcaccctgacctgcggcacctacagcaacgtgctgcggttc
ctgcctccgctcgtcatctccgacgacgagctgggccggggactggacatcctggcggcc
gccttcggctga

DBGET integrated database retrieval system