KEGG   Micromonospora sp. L5: ML5_1293Help
Entry
ML5_1293          CDS       T01379                                 

Definition
magnesium chelatase, chli subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mil00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1307179..1308669
Genome map
AA seq 496 aa AA seqDB search
MDRVTAPNQVSPVPPADLPSTLGGLRAAGHRYRTVKQELRDNLLARMGSGEDRFPGIVGY
EDTVLPEVERALLAGHDMVLLGERGQGKTRLIRSLGALLDEWTPVIPGSVLNEHPMHPLT
PASQALVDSAGYDLAIGWLHRSMRYGEKLATPDTSVGDLIGDVDPIRLAQGRTLGDPETI
HFGLVPRTNRGVFAVNELPDLAERIQVALLNVLEERDIQVRGYQLRLPLDLLLVASANPE
DYTNRGRIITPLKDRFGAEIRTHYPLDLDLELALIRQEADLVAVVPEHVLEVLARFARDV
RESPSVDPRSGVSARFAIAAAETVAAAALRRSGLLAGASAGAGASGGAAGSASRPEAPVA
RIGDTVSVTSTLRGKVEFESGEEGREIEVLAHLLRTATAETFRARLAGLDLSGFTAIVAE
GGAVETGELVSSSELLRQVGTVPGLAKVLDRLGLGDAPSPEEAAAGIEFVLEGLHLTRRL
GKDVTDSGRTVYGDRD
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgggtgaccgctcccaaccaggtttccccggtcccgcccgccgacctgccgagc
acactcggcgggctgcgcgcggccggccaccgctaccgcacggtcaaacaggaactccga
gacaacctcctcgcccggatgggctccggcgaggaccgcttccccggcatcgtgggctac
gaggacacggtgctgcccgaggtcgagcgcgcgctgctcgccgggcacgacatggtgctg
ctcggcgagcgcgggcagggcaagacccggctgatccgttcgctcggcgcgctgctggac
gagtggaccccggtgatccccggctcggtactcaacgagcacccgatgcacccgctcacc
ccggcgtcccaggcgctcgtcgactcggccggctacgacctggcgatcgggtggctgcac
cgctcgatgcggtacggcgagaagctcgccacgccggacaccagcgtcggtgacctgatc
ggcgacgtcgacccgatccgcctcgcccaggggcgcacgctcggcgacccggagaccatc
cacttcgggctcgtaccgcgtaccaaccggggcgtcttcgccgtcaacgagctgcccgac
ctggccgaacgcatccaggtggcgctgctcaacgtgctggaggaacgcgacatccaggtc
cgcggctatcagctacggctgccgctggacctgctgctcgtggccagtgccaacccggag
gactacaccaaccggggccggatcatcacgccgctgaaggaccggttcggcgcggagatc
cgtacccactatccgctcgacctggacctggagctggcgctgatccggcaggaggccgac
ctggtcgccgtcgtgccggagcacgtgctggaggtgctggcccggttcgcccgcgacgtg
cgggagtcgccgtcggtcgacccgcgctccggtgtgtccgcccggttcgccatcgccgcc
gcggagacggtggccgccgccgcgttgcgccgttcgggtctgctggccggtgcttctgcc
ggcgctggtgcctcgggtggggcggccgggtcggcgtcccggccggaggcgcctgtggcc
cggatcggggacaccgtgtcggtgacctccacgctgcgcggcaaggtcgagttcgagagc
ggcgaggagggacgcgagatcgaggtgctcgcgcacctgctgcgtaccgccaccgccgag
acgttccgcgcccggctcgccgggctcgacctgtccggcttcaccgcgatcgtcgccgag
ggcggcgccgtcgagaccggcgaactggtctcctcgtccgagctgctacgccaggtcggc
accgtgccggggctggccaaggtgctcgaccggctcgggctcggcgacgcgcccagcccg
gaggaggcggccgccggcatcgagttcgtgctggaagggctgcacctgacccgccggctc
ggcaaggacgtcaccgactccgggcgcaccgtctacggggaccgggactga

DBGET integrated database retrieval system