KEGG   Micromonospora sp. L5: ML5_1389Help
Entry
ML5_1389          CDS       T01379                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mil  Micromonospora sp. L5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_1389
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_1389
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ML5_1389
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ML5_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1406325..1407506)
Genome map
AA seq 393 aa AA seqDB search
MHLTHLECPRCGSEHPADVLQNLCGCGSPLLARYDLAAVAATVAPEQFGLRPADLWRYRE
LLPVADPRFVTTLGEGWTPMWRAPAYGHEIGIADLIVKDEGLTPTGSFKARGASVGVSRA
RELGVKRIAMPTNGNAGAAWATYAARAGMGATIAMPLAAPTICREECLAAGADLRLIDGL
INDAGRDIAELIAGSDGGIFDAGTLREPYRLEGKKTMGYEIVEQLGWQVPDVIVYPTGGG
VGLIGIHKALHELRELGWVEDRLPRLVAVQSTGCAPIVRAFAAGEERVTPWEDAHTVAFG
ITVPAPLGDELILSALRGSAGTAIAVDDAEILTDLRDFAAREGLLLCPEGAACLTAARHL
RAGGWIRPGERVVVLNTGAGLKYPGLVQGGAPS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcacctgacgcacctggagtgcccgcgctgcggcagtgaacacccggccgacgtgttg
cagaacctgtgcggctgtggctcgccgctgctggcccgctacgacctcgccgcggtggcc
gccaccgtcgccccggagcagttcgggctgcgcccggccgacctgtggcgctaccgggag
ctgctgccggtcgccgatccccgcttcgtcaccacgctgggcgagggctggacgccgatg
tggcgcgcgccggcgtacggccacgagatcggcatcgcggacctgatcgtcaaggacgag
gggctgaccccgaccgggtcgttcaaggcgcgcggcgcgtcggtgggcgtgagccgggcc
cgggagctgggcgtgaagcggatcgccatgcccacgaacggcaacgccggcgcggcctgg
gccacctacgcggcgcgggccgggatgggcgcgacgatcgccatgccgctggccgcgccg
acgatctgccgcgaggagtgcctcgccgccggcgccgacctgcggctgatcgacggcctg
atcaacgacgcgggccgggacatcgccgagctgatcgccgggtcggacggggggatcttc
gacgccggcacgctgcgcgagccgtaccgcctcgaaggcaaaaagaccatggggtacgag
atcgtcgagcagctcggctggcaggtgcctgacgtgatcgtctatccgaccggcggtggc
gtcgggctgatcggcatccacaaggcgctgcacgagctgcgcgaactgggctgggtggag
gaccggctgccccggctggtcgcggtgcagtccaccgggtgcgcgccgatcgtgcgggcg
ttcgcggccggggaggagcgcgtcaccccgtgggaggacgcgcacaccgtcgcgttcggc
atcaccgtgcccgcgccgctcggcgacgagctgatcctgtccgcgctgcggggcagcgcc
ggcaccgcgatcgcggtggacgacgcggagatcctcaccgacctgcgtgacttcgccgcc
cgggaagggctgctgctctgcccggagggcgcggcctgcctgaccgccgcccggcacctg
cgcgcgggcgggtggatccggcccggggagcgcgtggtggtgctcaacaccggcgcgggc
ctgaaataccccggcctggtgcaaggaggggccccttcttaa

DBGET integrated database retrieval system