KEGG   Micromonospora sp. L5: ML5_1607Help
Entry
ML5_1607          CDS       T01379                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mil  Micromonospora sp. L5
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mil03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1647198..1648055
Genome map
AA seq 285 aa AA seqDB search
MPELPEVETVRVGLAQWVIGRRIAAVEVRHPRAVRRHAPGGAHFADVLAGRTVTGVQRRG
KYLWLPLDSGDAVIGHLGMSGQLLLQPVGAADELHLRVRFRFADDGPELRFVDQRTFGGL
SVSEGGAELPAEIAHIARDPMDPEFSDEAFVAALRRKRTEIKRALLDQTLISGVGNIYAD
EALWRAKLHGTRPADALTRPAALRLLGHVRDVLAEAIKQGGTSFDELYVNVNGESGYFDR
SLNAYGREGEPCPRCGAPIRREAFMNRSSYSCPRCQPRPRGTLRG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctgcccgaggtcgagaccgtccgggtgggactcgcccagtgggtgatcggc
cggcggatcgccgccgtcgaggtacgccacccccgcgccgtacgccggcacgcgcccggt
ggcgcgcacttcgccgacgtgctcgccggccggacggtcaccggcgtgcagcgccggggc
aagtacctctggctgccgctggacagcggcgacgcggtgatcggccacctcggcatgtcc
ggccagctgctgctgcagccggtcggcgcggccgacgaactgcacctgcgggtccggttc
cgattcgccgacgacgggccggagctgcgcttcgtcgaccagcgcacgttcggcgggctg
tccgtgtccgaaggtggggcggagctgcccgccgagatcgcccacatcgcgcgcgacccg
atggacccggagttctccgacgaggcgttcgtggcggcgctgcggcgcaagcgtacggag
atcaaacgcgcgctgctcgaccagacgctgatctccggagtgggcaacatctacgccgac
gaggcactgtggcgggcgaagctgcacggcacccgcccggccgacgcgctcacccgtccg
gccgcgctgcggctgctcggacacgtccgggacgtgctcgccgaggcgatcaagcagggt
ggcaccagcttcgacgagctgtacgtcaacgtcaacggcgagagcggctacttcgaccgg
tcgctgaacgcgtacggccgggagggggagccctgcccgcgctgcggcgcgccgatccgg
cgggaggcgttcatgaaccggtcctcctacagctgcccgcgatgccagccgcggccccgg
ggcaccctccggggatga

DBGET integrated database retrieval system