KEGG   Micromonospora sp. L5: ML5_1887Help
Entry
ML5_1887          CDS       T01379                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mil  Micromonospora sp. L5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mil00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1943737..1945146
Genome map
AA seq 469 aa AA seqDB search
MVRPWRVAIVGGGITGLAAAVRLRDRAPEGTEITVYEQSGRLGGKLHTGELAGGPVEFGA
ESFLMRDPAGGESAAVTLARRLGLDASIVHPTVGQAALLVDGTLRQVPGGTLVGVPGDLD
KVAAVAPPAADADRDAGHPLLAEGEDTSVGELVRKRLGDAVVERLVDPMLGGVYAGRADD
LSLVTTMPALARAARAEHTLVGAVRAAQAAAPRAPGAPVFGTLAGGLSTLVEAAATASGA
TIRRGAAVRELRRTPDGWRLTVGPTRDAEHVEADAVLLAVPARPAARLLAAAAPEAAGTV
GALDYASVALITLALPGPALPELSGFLVPAGEGLTIKASTFFTTKWGHLRRPDGLALVRA
SVGRYGDETSLQLTDDDLADTVHRELSAVLGAPLPVPVARHVQRWGGALPQYTPGHTARV
AAVRTALRAAHPTLAVAGAGYDGVGIPVCVRSGETAAEEIITALEGSAA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgaccgtggcgggtggcgatcgtcggtggcgggatcaccgggctggccgccgcc
gtccggttgcgcgaccgggcccccgagggcaccgagatcaccgtgtacgagcagtccggc
cgcctcggcggcaagctgcacaccggtgagctggccggcgggccggtcgagttcggcgcg
gagtcgttcctgatgcgcgacccggccggtggcgagtcggcggcggtgacgctggcccgc
cgcctcggactggacgcgtcgatcgtgcacccgaccgtcgggcaggcggccctgctcgtc
gacggcacgttgcgccaggtcccgggcgggacgctcgtcggcgtacccggggatctggac
aaggtggcggcggtcgcgccgccggccgcggacgccgaccgcgacgcgggccacccgctg
ctggccgagggtgaggacacctcggtcggtgagctggtccgcaagcgtctcggagacgcg
gtggtggagcggctggtcgacccgatgctcggcggcgtgtacgccgggcgggccgacgac
ctgtcgcttgtcaccacgatgccggcgctggcccgcgcggcccgcgccgagcacacgctg
gtcggtgcggtacgcgccgcgcaggccgccgcgccgcgcgcgcccggcgcaccggtcttc
ggcacgctcgccggtgggctgagcacgctggtcgaggcggcggcgacggcgagcggggcg
acgatccgccggggcgccgcggtacgcgagctgcgccgcaccccggacggctggcggctc
acagtcgggccgacccgcgacgccgagcacgtcgaggcggacgcggtgctgctcgcggtg
ccggcccgcccggccgcccggctgctcgccgccgccgcgcccgaggcggccggcacggtg
ggcgcgctcgactacgcgagcgtcgccctgatcaccctcgcgctgccggggccggccctg
ccggagctgtccggcttcctggtgccggccggcgaagggctgacgatcaaggcgtccacg
ttcttcaccaccaagtgggggcacctgcggcggccggacgggctggcgctggtgcgcgcc
tcggtgggccggtacggcgacgagacgtcgctgcagctcaccgacgacgacctggccgac
acggtgcaccgggagctgtcggcggtgctgggcgcgccgctgccggtgccggtggcccgg
cacgtgcagcggtggggtggcgcgctgccccagtacacgcccgggcacaccgcccgggtg
gcggcggtccggacggcgctgcgcgccgcccacccgacgcttgcagtggccggggccggt
tacgacggcgtcggtatcccggtgtgcgtccgctccggcgagacggcggccgaagagatc
atcacggcactggaaggatcggcagcatga

DBGET integrated database retrieval system