KEGG   Micromonospora sp. L5: ML5_1956Help
Entry
ML5_1956          CDS       T01379                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mil  Micromonospora sp. L5
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ML5_1956
Enzymes [BR:mil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     ML5_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2021161..2023563)
Genome map
AA seq 800 aa AA seqDB search
MDTAVNLHSPLTEDELRRLDAYWRAANYLTVGQIYLLDNPLLREPLKPEHVKPRLLGHWG
TSPGLNLLYTHLNRVIVNRDLSAIFVTGPGHGGPALVANTWLEGTYSELYHHIPRDETGM
QRLFRQFSFPGGIPSHVAPEVPGSIHEGGELGYALSHAYGAAFDNPDLLVACVIGDGEAE
TGPLAGSWLSNVFLNPARDGAVLPILHLNGYKIANPTVLDRIPREDLRDMMRGFGYEPYV
VEGDDPATVHQLLAATLDRAVDEITAIQRRARSGEHVERPRWPMIVLRTPKGWTGPSRVD
GKQVEGTFRAHQVPISEVRDNPAHLAELERWLRSYRPEELFDATGGPVAEVADLPPTGDH
RMSANPVANGGRLLRNLELPDFRDYAVDVPTPGEPMAGATGVLGPWVRDVIARNPETFRL
FGPDEVASNRLGAAFEVTDRAFVGAEVPGDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGR
HGIFTSYEAFIHIVDSMVNQHAKWLKVTRNIPWREPVASLNYLLSSHVWRQDHNGFSHQD
PGFIDHVVNKKAEVVRVYLPPDGNTLLSTMDHCLRSRQYINVVVAGKQPAPNWLTMDEAI
QHCRRGLGIWDWASSDDGTEPDVVLACAGDVPTLETLAAVDLLRRHLPDLKVRVVNVVDL
MRLQPPSEHPHGLPDNEFDTIFTRDKPVIFAYHGYPWLIHRLTYRRTNHENLHVRGYKEE
GTTTTPFDMVMLNDLDRFHLVIDVIDRVPGLRSRAAHLRQDMVDARQACRDYTRRYGEDD
PRVAEWRWIRENDPAVRSGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcggtgaacctgcacagccccctgaccgaagacgagttgcgccggctggac
gcctactggcgcgcggcgaactacctgaccgtcggccagatctatctgctcgacaatccg
ctgctgcgcgaaccgctcaagcccgagcacgtcaagccgcgcctgctgggccactggggc
accagccccgggctcaacctgctctacacgcacctcaaccgggtcatcgtgaaccgggac
ctgtccgccatcttcgtcaccggccccggccacggcggcccggcgctggtggcgaacacc
tggctggagggcacctacagcgagctgtaccaccacatcccccgggacgagaccggcatg
cagcggctgttccggcagttctccttcccgggcggcatcccgagccacgtggcgccggag
gtgccgggttcgatccacgagggcggcgagctggggtacgcgctgagccacgcgtacggc
gccgcgttcgacaacccggacctgctggtggcctgcgtgatcggcgacggcgaggcggag
accggtccgctggccggaagctggctgtcgaacgtgttcctcaacccggcccgcgacggc
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgacggtgctggac
cggatcccccgcgaggacctgcgggacatgatgcgcggcttcggctacgagccgtacgtg
gtcgagggcgacgacccggcgacggtgcaccagctgctggccgccacgctcgaccgggcg
gtcgacgagatcaccgcgatccagcgccgggcccgctccggcgagcacgtcgagcgtccc
cgctggccgatgatcgtcctgcggacgccgaagggctggaccgggccgtcccgggtcgac
ggcaagcaggtcgagggcacgttccgcgcccaccaggtgccgatctccgaggtgcgggac
aacccggcgcacctggccgagctggagcgctggctgcgcagctaccggccggaggagctg
ttcgacgccaccggcggcccggtcgccgaggtggccgacctgccgcccacaggtgaccac
cggatgagcgccaacccggtcgccaacggcggcaggctgctgcgcaacctggagctgccg
gacttccgcgactacgcggtcgacgtaccgacgccgggtgagccgatggccggcgcgaca
ggtgtgctcgggccctgggtccgggacgtgatcgcccgcaacccggagacgttccgcctg
ttcggcccggacgaggtcgcctcgaaccggctcggcgcggcgttcgaggtgaccgaccgc
gcgttcgtgggcgccgaggtgcccggcgacgaccacctctcccccgacggccgggtgatg
gaggtgctctccgagcacctgtgccagggctggctggagggctacctgctgaccggccgg
cacggcatcttcaccagctacgaggcgttcatccacatcgtcgactcgatggtcaaccag
cacgccaagtggctgaaggtgacccggaacatcccctggcgggagccggtggcgtcgctg
aactacctgctgtccagccacgtgtggcgccaggaccacaacggcttctcgcaccaggat
ccgggcttcatcgaccacgtggtgaacaagaaggccgaggtggtccgggtctacctgccg
ccggacggcaacacgctgctgtccacgatggatcactgcctgcgcagccggcagtacatc
aacgtggtggtggccggcaagcagcccgcgccgaactggctgaccatggacgaggcgatc
cagcactgccgccgcggcctgggcatctgggactgggccagcagcgacgacggcaccgag
ccggacgtggtgctcgcctgcgccggtgacgtgccgacgctggagacgctcgccgccgtc
gacctgctgcgccggcacctgccggacctgaaggtgcgggtcgtcaacgtggtcgacctg
atgcgcctgcaaccgccgtcggagcacccgcacggcctgccggacaacgagttcgacacc
atcttcacccgcgacaagccggtgatcttcgcgtaccacgggtacccgtggctgatccac
cggctcacctaccgccggaccaaccacgagaacctgcacgtgcgcggttacaaggaggag
ggcaccaccacgacgccgttcgacatggtgatgctcaacgacctggaccgcttccacctg
gtcatcgacgtgatcgaccgggtgccggggctgcggtcgcgcgccgcgcacctgcgccag
gacatggtggacgcccgccaggcctgccgcgactacacccgccgctacggcgaggacgac
ccccgggtcgccgagtggcgctggatccgcgagaacgatccggccgtgaggagtggggaa
tga

DBGET integrated database retrieval system