KEGG   Micromonospora sp. L5: ML5_1956Help
Entry
ML5_1956          CDS       T01379                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
mil  Micromonospora sp. L5
Pathway
mil00030  Pentose phosphate pathway
mil01100  Metabolic pathways
mil01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ML5_1956
Enzymes [BR:mil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     ML5_1956
    4.1.2.22  fructose-6-phosphate phosphoketolase
     ML5_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADU07484
JGI: ML5_1956
Position
complement(2021161..2023563)
Genome map
AA seq 800 aa AA seqDB search
MDTAVNLHSPLTEDELRRLDAYWRAANYLTVGQIYLLDNPLLREPLKPEHVKPRLLGHWG
TSPGLNLLYTHLNRVIVNRDLSAIFVTGPGHGGPALVANTWLEGTYSELYHHIPRDETGM
QRLFRQFSFPGGIPSHVAPEVPGSIHEGGELGYALSHAYGAAFDNPDLLVACVIGDGEAE
TGPLAGSWLSNVFLNPARDGAVLPILHLNGYKIANPTVLDRIPREDLRDMMRGFGYEPYV
VEGDDPATVHQLLAATLDRAVDEITAIQRRARSGEHVERPRWPMIVLRTPKGWTGPSRVD
GKQVEGTFRAHQVPISEVRDNPAHLAELERWLRSYRPEELFDATGGPVAEVADLPPTGDH
RMSANPVANGGRLLRNLELPDFRDYAVDVPTPGEPMAGATGVLGPWVRDVIARNPETFRL
FGPDEVASNRLGAAFEVTDRAFVGAEVPGDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGR
HGIFTSYEAFIHIVDSMVNQHAKWLKVTRNIPWREPVASLNYLLSSHVWRQDHNGFSHQD
PGFIDHVVNKKAEVVRVYLPPDGNTLLSTMDHCLRSRQYINVVVAGKQPAPNWLTMDEAI
QHCRRGLGIWDWASSDDGTEPDVVLACAGDVPTLETLAAVDLLRRHLPDLKVRVVNVVDL
MRLQPPSEHPHGLPDNEFDTIFTRDKPVIFAYHGYPWLIHRLTYRRTNHENLHVRGYKEE
GTTTTPFDMVMLNDLDRFHLVIDVIDRVPGLRSRAAHLRQDMVDARQACRDYTRRYGEDD
PRVAEWRWIRENDPAVRSGE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgcggtgaacctgcacagccccctgaccgaagacgagttgcgccggctggac
gcctactggcgcgcggcgaactacctgaccgtcggccagatctatctgctcgacaatccg
ctgctgcgcgaaccgctcaagcccgagcacgtcaagccgcgcctgctgggccactggggc
accagccccgggctcaacctgctctacacgcacctcaaccgggtcatcgtgaaccgggac
ctgtccgccatcttcgtcaccggccccggccacggcggcccggcgctggtggcgaacacc
tggctggagggcacctacagcgagctgtaccaccacatcccccgggacgagaccggcatg
cagcggctgttccggcagttctccttcccgggcggcatcccgagccacgtggcgccggag
gtgccgggttcgatccacgagggcggcgagctggggtacgcgctgagccacgcgtacggc
gccgcgttcgacaacccggacctgctggtggcctgcgtgatcggcgacggcgaggcggag
accggtccgctggccggaagctggctgtcgaacgtgttcctcaacccggcccgcgacggc
gcggtgctgccgatcctgcacctcaacggctacaagatcgccaacccgacggtgctggac
cggatcccccgcgaggacctgcgggacatgatgcgcggcttcggctacgagccgtacgtg
gtcgagggcgacgacccggcgacggtgcaccagctgctggccgccacgctcgaccgggcg
gtcgacgagatcaccgcgatccagcgccgggcccgctccggcgagcacgtcgagcgtccc
cgctggccgatgatcgtcctgcggacgccgaagggctggaccgggccgtcccgggtcgac
ggcaagcaggtcgagggcacgttccgcgcccaccaggtgccgatctccgaggtgcgggac
aacccggcgcacctggccgagctggagcgctggctgcgcagctaccggccggaggagctg
ttcgacgccaccggcggcccggtcgccgaggtggccgacctgccgcccacaggtgaccac
cggatgagcgccaacccggtcgccaacggcggcaggctgctgcgcaacctggagctgccg
gacttccgcgactacgcggtcgacgtaccgacgccgggtgagccgatggccggcgcgaca
ggtgtgctcgggccctgggtccgggacgtgatcgcccgcaacccggagacgttccgcctg
ttcggcccggacgaggtcgcctcgaaccggctcggcgcggcgttcgaggtgaccgaccgc
gcgttcgtgggcgccgaggtgcccggcgacgaccacctctcccccgacggccgggtgatg
gaggtgctctccgagcacctgtgccagggctggctggagggctacctgctgaccggccgg
cacggcatcttcaccagctacgaggcgttcatccacatcgtcgactcgatggtcaaccag
cacgccaagtggctgaaggtgacccggaacatcccctggcgggagccggtggcgtcgctg
aactacctgctgtccagccacgtgtggcgccaggaccacaacggcttctcgcaccaggat
ccgggcttcatcgaccacgtggtgaacaagaaggccgaggtggtccgggtctacctgccg
ccggacggcaacacgctgctgtccacgatggatcactgcctgcgcagccggcagtacatc
aacgtggtggtggccggcaagcagcccgcgccgaactggctgaccatggacgaggcgatc
cagcactgccgccgcggcctgggcatctgggactgggccagcagcgacgacggcaccgag
ccggacgtggtgctcgcctgcgccggtgacgtgccgacgctggagacgctcgccgccgtc
gacctgctgcgccggcacctgccggacctgaaggtgcgggtcgtcaacgtggtcgacctg
atgcgcctgcaaccgccgtcggagcacccgcacggcctgccggacaacgagttcgacacc
atcttcacccgcgacaagccggtgatcttcgcgtaccacgggtacccgtggctgatccac
cggctcacctaccgccggaccaaccacgagaacctgcacgtgcgcggttacaaggaggag
ggcaccaccacgacgccgttcgacatggtgatgctcaacgacctggaccgcttccacctg
gtcatcgacgtgatcgaccgggtgccggggctgcggtcgcgcgccgcgcacctgcgccag
gacatggtggacgcccgccaggcctgccgcgactacacccgccgctacggcgaggacgac
ccccgggtcgccgagtggcgctggatccgcgagaacgatccggccgtgaggagtggggaa
tga

DBGET integrated database retrieval system