KEGG   Micromonospora sp. L5: ML5_1971Help
Entry
ML5_1971          CDS       T01379                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mil  Micromonospora sp. L5
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ML5_1971
  Lipid metabolism
   00561 Glycerolipid metabolism
    ML5_1971
   00600 Sphingolipid metabolism
    ML5_1971
Enzymes [BR:mil01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ML5_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2035327..2037540)
Genome map
AA seq 737 aa AA seqDB search
MTIVHLRRARTSLVLDARGPGLPRVVHWGADLGPLPDEDLPAVVDATVPPVVPSSFDTPT
VLSLLPEASAGWSGRPGLAGHRDGRDWSTAFRLTGLDVYDEPAAPSPALLGGAPLHAPGV
NKGPFLSSGRVEVRAADPGAGLSLTVEITLDAAGVLTLRHRLRNDGDGRYEVRELTPVLP
VPAVATELLDLTGRWCRERAPQRHPWPMGAWVREGRHGRTGHDATLLLVAGTAGFGFRHG
EVWAVHTGWSGDHVTAAERRPTGESTLGGGELLAPGEIVLGPGEEYATPLLYAAHSADGL
DGLSDALHTHLRARPSHPRTPRPVTLNVWEAVYFDHDLDRLRALADAAAEVGVERFVLDD
GWFRGRRHDQAGLGDWWVDGEVWPDGLQPLIDHVRGHGMQFGLWVEPEMVNPDSDLFRAH
PDWVLQAPGRLPPPWRHQQVLDLAHPDAYAYLLERLDAVLSEHDGLAYLKWDHNRDLTEA
GHAGRPGVHAQTLAVYRLLDELRARHPDVEIESCSSGGARVDLEILRRTDRVWASDCNDA
LERLSIQRWTGLLLPPELIGTHIGPERSHTTHRVHDLSFRAVTALFGHHGIEWDITAIDA
GERAELAAWVALHKRLRPLLHTGRVVRVDHPDPAVQAHGVVAHDRNHAVYAVSRVATSAA
QVPGAVRLPGLDPQRRYRVRPPAGVPEPALLELSPPGWLAWPGDGITVSGSVLGTVGVQL
PALHPEQALLLEVTVVG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgtccacctgcgccgcgcgcggaccagcctggtgctcgacgcccgcggcccg
gggctgccccgggtcgtgcactggggcgccgacctcggcccgctgcccgacgaggacctg
cccgcggtcgtcgacgccacggtgccgccggtggtgccgagcagcttcgacacgcccact
gtgctgtcgctgctgcccgaggcgagcgccgggtggagcggacgtcccggtctcgccggt
caccgcgacggccgggactggtcgacggcgttccgcctcaccggcctcgacgtgtacgac
gagcccgcggcaccgtcgcccgccctgttaggaggggcccctttacatgcaccaggcgtt
aacaaggggcccttcctttcctccgggcgggtggaggtgcgggcggcggatccgggcgcg
gggctgagcctgaccgtcgagatcacgctggacgcggcgggcgtgctgacgctgcggcac
cggctgcgcaacgacggcgacggccggtacgaggtgcgggagctgacaccggtgctgccg
gtgccggcggtcgccaccgaactgctcgacctgaccggccgctggtgccgggagcgcgcg
ccgcagcggcacccgtggccgatgggcgcctgggtacgcgaggggcggcacggccgtacc
ggccacgacgccacgttgttgctggtcgcgggcaccgccgggttcggtttccggcacggc
gaggtgtgggcggtgcacaccgggtggagcggcgaccacgtcaccgccgccgagcgccgc
cccacaggtgagtccacgctcggcggcggtgagctgctcgcacccggcgagatcgtgctc
gggccgggcgaggagtacgccactcccctgctctacgcggcgcactcggccgacgggctg
gacgggctcagcgacgcgctgcacacccacctgcgggcccgcccgtcgcacccccgcacg
ccgcgaccggtgacgctgaacgtgtgggaggcggtctacttcgaccacgacctggaccgg
ctgcgggcgctggccgacgcggccgccgaggtcggtgtggaacgcttcgtgctggacgac
ggctggttccgtggccgacgacacgaccaggccgggctcggcgactggtgggtcgacggc
gaggtctggccggacgggttgcagccgctgatcgaccacgtacgcgggcacggcatgcag
ttcgggctctgggtggaaccggagatggtcaaccccgactccgacctgttccgcgcccac
cccgactgggtgcttcaggcgccgggccggctgccgccgccgtggcggcaccagcaggtg
ctcgacctggcccacccggacgcgtacgcgtacctgctcgaacggctcgacgcggtgctg
agcgagcacgacgggctcgcgtacctgaagtgggaccacaaccgcgacctcaccgaggcc
gggcacgccgggcggcccggggtgcacgcgcagaccctcgcggtctaccggttgctggac
gagctgcgcgcccggcacccggacgtcgagatcgagagctgctcctccggcggcgcgcgc
gtcgacctggagatcctgcgccgcaccgaccgggtctgggccagcgactgcaacgacgcg
ctggaacggctgtccatccagcgctggaccggcctgctgctgccgccggaactgatcggc
acgcacatcggcccggagcgctcgcacaccacgcaccgcgtacacgacctgagcttccgc
gcggtcaccgcgctgttcggccaccacggcatcgagtgggacatcaccgcgatcgacgcc
ggcgaacgggccgaactcgccgcctgggtggcgctgcacaagcggctgcgcccgctgctg
cacaccggccgggtggtccgggtcgaccacccggacccggccgtgcaggcccacggcgtg
gtcgcccacgaccgcaaccatgcggtgtacgcggtcagccgggtcgccacctcggcggcg
caggtgccgggcgcggtgcggctgccggggctggacccgcagcggcgctaccgggtccgt
ccacccgccggagtaccggaaccggccctgctggagctgtccccgccgggctggctggcc
tggccgggcgacggcatcacggtgagcggttcggtgctgggcacggtcggcgtgcagctc
cccgccctgcaccccgaacaggccctcctcctggaggtcaccgtcgtcggctga

DBGET integrated database retrieval system