KEGG   Micromonospora sp. L5: ML5_2125Help
Entry
ML5_2125          CDS       T01379                                 

Definition
d-amino-acid oxidase (EC:1.4.3.3)
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
mil  Micromonospora sp. L5
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_2125
   00330 Arginine and proline metabolism
    ML5_2125
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    ML5_2125
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    ML5_2125
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     ML5_2125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2191854..2192807
Genome map
AA seq 317 aa AA seqDB search
MGVMTKADVVVVGGGVIGMTTALTLQRRGAHVTVLTAHDPADTVSTVAAAVWYPSHTEED
PRVLRWARDTHAELRRQAADGVPGVVDRPTRMWLRHRYAGPPWWADACGDLTAEPAEPPY
TALLRFTAPSVEMTPYLAWLRQRLEAGGGRIVGRALGTLAEAYEVAPVVVNATGLAAGRL
AADPAVYPARGHVLLVANPGLTVSVRDEDDPAGVTYVHPRRHDVVLGGTYEAGVGHTRPD
PEEAAAIRRRCVALVPQLADAPVLGERIGLRPARHGGPRVEVDPADVRLVHAYGHGGAGV
TLSWGCAAEVADLALGV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatgacgaaggcggacgtggtggtggtcggcggcggggtgatcgggatgacg
acggcgctcacgctccagcggcggggcgcacacgtcaccgtcctgaccgcccacgacccg
gccgacacggtgtcgacggtggccgccgcggtctggtacccgagccacaccgaggaggat
ccccgggtgctgcgctgggcccgggacacccacgccgagctgcgccgccaggcggccgac
ggggtgccgggagtggtcgaccggcccacccggatgtggttgcgccaccgctacgccggg
ccgccctggtgggccgacgcctgcggcgacctgacggccgagccggcggagccgccgtac
accgcgctgctgcggttcaccgccccgtcggtggagatgaccccgtacctcgcctggctc
cggcagcgcctggaggcgggcggcggccggatcgtcggccgcgcgctgggcacgctcgcc
gaggcgtacgaggtcgccccggtcgtggtgaacgcgaccggcctggccgccggccggctc
gccgccgacccggccgtgtacccggcgcgcgggcacgtcctgctggtggcgaacccgggc
ctgaccgtctcggtacgcgacgaggacgacccggcgggcgtcacgtacgtgcatccgcgc
cgccacgacgtggtgctcggcggcacctacgaggccggggtgggacacacccgccctgac
ccggaggaggcggcggcgatccggcgccggtgcgtggcgctggtgccgcagctcgcggac
gcgccggtgctgggggagcggatcgggctgcggccggcccggcacggcggcccccgggtg
gaggtggacccggcggacgtgcggctggtgcacgcgtacgggcacggcggcgccggggtg
acgctgtcctggggctgcgccgccgaggtggccgacctggccctgggcgtctga

DBGET integrated database retrieval system