KEGG   Micromonospora sp. L5: ML5_2213Help
Entry
ML5_2213          CDS       T01379                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mil  Micromonospora sp. L5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ML5_2213
Enzymes [BR:mil01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ML5_2213
Exosome [BR:mil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ML5_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2291055..2293157)
Genome map
AA seq 700 aa AA seqDB search
MDQLIAGEVHDPHAVLGAHPADGSTTIRTLRRGAGEVAVLADGERHPMKRVHDAGVFEAV
LPGEVLDYRVEVDGTTHDDPYRYPPTLGDLDLHLIGEGRHERLWAALGARVFDEGVAFTV
WAPNARAVRLIGDVTGWAPDDGWPMRSLGSSGVWEIFVPGMPVGSRYKYRVLGADGRWRD
KADPMAARTEVPPATASVVHESRYEWGDADWLARRSRQAPHQEPMSVYEVHLGSWRPGLG
YRELADQLTAYVLEMGFTHVEFLPVMEHPFGGSWGYQVTGYYAPTARFGDPDDFRHLVDR
LHAAGIGVLLDWVPAHFPKDEWALARFDGTPLYEHPDPRRGEHPDWGTYVFDFGRNEVRN
FLVANALYWLDEFHIDGLRVDAVASMLYLDYSRQDGQWAPNVHGGRENLEAIAFLQEVNA
TVYRHHPGVLMIAEESTAWPGVTRPTSEGGLGFGFKWNMGWMHDTLLYTSKDPIYRQHHH
HQLTFSLAYAWSENYVLPISHDEVVHGKGSLAGKMPGDTWQRLATVRALLAYMWAHPGKQ
LLFMGCELADDREWSEERGLDWYLTHDPARAGVQRLVADLNRLYRESPALWAQDTDPAGF
RWIAGDDVANNAVSFIRIAPDGQTLVCVANFSALPLEDYRIGLPAAGTWTEALNTDAHHY
GGSGVGNLGEVHAENVPWHGLPASVSLRVPPLGVLWLRPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaccagctgatcgccggcgaggtacacgacccgcacgccgtgctcggcgcgcacccg
gccgacgggagcaccacgatccggacgctgcgccggggcgcgggcgaggtggcggtgctc
gccgacggcgagcggcacccgatgaagcgggtccacgacgccggtgtcttcgaggcggtc
ctccccggtgaggtgctggactaccgggtcgaggtggacggcacgacgcacgacgacccg
taccgttatccgcccacgctcggcgacctcgacctgcacctgatcggcgaggggcggcac
gagcggctctgggcggcgctcggcgcccgggtgttcgacgagggcgtcgcgttcaccgtc
tgggcgccgaacgcacgggccgtgcggctgatcggcgacgtcaccggctgggcgccggac
gacgggtggccgatgcgctcgctcggctccagcggcgtgtgggagatcttcgtgccgggc
atgccggtgggcagccgctacaagtaccgcgtcctcggcgcggacggccggtggcgggac
aaggccgacccgatggccgcgcgcaccgaggtgccgccggccaccgcgtcggtggtgcac
gagtcacggtacgagtggggcgacgcggactggctcgcgcgccggtcccggcaggcgccg
caccaggagccgatgagcgtgtacgaggtgcacctgggctcctggcgacccggcctcggc
taccgggagctggccgatcagctcaccgcgtacgtgctggagatgggcttcacccacgtg
gagttcctgccggtgatggagcacccgttcggcggctcgtggggctaccaggtcaccggc
tactacgcgccgacggcccggttcggcgacccggacgacttccgccacctggtggaccgg
ctgcacgccgccggcatcggcgtgctcctggactgggtgccggcgcacttcccgaaggac
gagtgggcgctcgcccgtttcgacggcaccccgctgtacgagcaccccgacccgcgtcgc
ggcgagcaccccgactggggcacgtacgtcttcgacttcggccgcaacgaggtgcgcaac
ttcctggtcgccaacgcgctgtactggctcgacgagttccacatcgacgggctgcgggtg
gacgcggtcgcctcgatgctctacctggactattcccggcaggacgggcagtgggcgccg
aacgtgcacggcggccgggagaacctggaggccatcgcgttcctccaggaggtcaacgcc
accgtctaccggcaccacccgggcgtactgatgatcgccgaggagtccaccgcctggccc
ggcgtcacccggcccacctcggagggcgggctcgggttcgggttcaagtggaacatgggc
tggatgcacgacaccctgctctacacctcgaaggacccgatctaccggcagcaccaccac
catcagctcacgttctcgctggcgtacgcgtggagcgagaactacgtgctgccgatcagc
cacgacgaggtggtgcacggcaagggctcgctcgccggcaagatgcccggcgacacctgg
cagcgactggccacggtgcgggcgctgctggcgtacatgtgggcgcacccgggcaagcag
ttgctcttcatgggctgcgagctggccgacgacagggagtggagcgaggagcgcggcctc
gactggtacctgacccacgatccggcccgcgcgggcgtgcagcggctggtcgccgacctg
aaccggctctaccgggagagcccggcgctctgggcgcaggacaccgacccggccggcttc
cgctggatcgccggggacgacgtggccaacaacgcggtgtcgttcatccggatcgccccg
gacgggcagacgctcgtgtgcgtggcgaacttctccgcgctgccgctggaggactaccgg
atcggcctgcccgcggccgggacgtggaccgaggcgctgaacaccgacgcccaccactac
ggcgggtcgggggtgggcaacctgggcgaggtgcacgccgagaacgtgccgtggcacggc
ctgcccgcgtcggtctccctgcgcgtgccgccgctgggcgtcctctggctccgcccggcc
tga

DBGET integrated database retrieval system