KEGG   Micromonospora sp. L5: ML5_2247Help
Entry
ML5_2247          CDS       T01379                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mil  Micromonospora sp. L5
Pathway
mil00071  Fatty acid degradation
mil00280  Valine, leucine and isoleucine degradation
mil00281  Geraniol degradation
mil00310  Lysine degradation
mil00362  Benzoate degradation
mil00380  Tryptophan metabolism
mil00410  beta-Alanine metabolism
mil00640  Propanoate metabolism
mil00650  Butanoate metabolism
mil00903  Limonene and pinene degradation
mil00930  Caprolactam degradation
mil01040  Biosynthesis of unsaturated fatty acids
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01120  Microbial metabolism in diverse environments
mil01130  Biosynthesis of antibiotics
mil01200  Carbon metabolism
mil01212  Fatty acid metabolism
Module
mil_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML5_2247
   00650 Butanoate metabolism
    ML5_2247
  Lipid metabolism
   00071 Fatty acid degradation
    ML5_2247
   01040 Biosynthesis of unsaturated fatty acids
    ML5_2247
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML5_2247
   00310 Lysine degradation
    ML5_2247
   00380 Tryptophan metabolism
    ML5_2247
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML5_2247
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML5_2247
   00281 Geraniol degradation
    ML5_2247
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML5_2247
   00930 Caprolactam degradation
    ML5_2247
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ML5_2247
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ML5_2247
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ML5_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DFP NAD_Gly3P_dh_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADU07770
JGI: ML5_2247
Position
2333779..2335926
Genome map
AA seq 715 aa AA seqDB search
MANTIRWEHGDDGIVLLTLDHPGRSANVMNAEFGESLAATVDRLEAERDRITGVIVTSAK
KTFFAGGDLETLVRLTPADAEASAADAAALKQAVRRLETLGRPVVAAVNGSALGGGLELA
LGCHHRVVLDDPAIEIGFPEVTLGLLPGCGGVVRTVRLLGVTAALTDWLLRGQRRRPQDA
LAHGLVDELAADRDALMAAAREWIAAHPDATQPYDRKDYRMPGGTPSSPGLAVQLPAMPA
LLRKQLKDAPYPAPRNILAAAVEGAQVDLDTAFVIEGRYFTELATGQVAKNMIKALFFDL
QTARSRTAGGDHEPVRSVAVAGAGMMGAAIAYVCARAGMRVVLKDVTAEGAARGKAYSAG
LLDKAVARGRSTPEKRDEILGRIHATGDLADLAGVDLAIEAVFEDPALKHKVYAEIEQVA
PDALIASNTSTLPITLLAEGVSRPEEFVGLHFFSPVDKMPLVEVIRGERTDEATLGRALG
VVRQLRKTPIVVNDSRGFFTSRVIGTFTNEGVAMLAEGIPAATIEQASSQAGYPAPVLAL
MDELTLTLPRKIRQETAAATVAAGGTWQPHAADAVIDRMIDECGRTGRSGGAGFYDYRDG
KRAGLWPGLREQFGGTNLDTPFEDLKERMLFIEAIESVRCLEEGVLTSVADANVGSILGI
GYPSWTGGVLQYVNQYDGGLPGFVARARVLAERYGERFDPPPLLTAMAERGERFE
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaccatccggtgggagcacggcgacgacggcatcgtgctgctcaccctcgac
caccccggccgctcggcgaacgtgatgaacgcggagttcggcgagagcctggcggccacc
gtggaccggctcgaagccgagcgtgaccggatcaccggcgtgatcgtcacctcggccaag
aagacgttcttcgccggcggcgacctggagaccctggtgcggctcacgcccgccgacgcc
gaggcgtcggcggccgacgcggccgcgctcaagcaggccgtacgccggctggagacgctc
ggccgcccggtcgtcgccgccgtcaacggatcggccctcggcggcggactggaactggcc
ctgggctgccaccaccgcgtcgtgctcgacgacccggccatcgagatcggctttcccgag
gtcacgctcggtctgctgcccggctgcggcggcgtggtgcgtaccgtccggctgctcggc
gtcaccgccgcgctgaccgactggctgctgcgcggccagcgccgccggccgcaggacgcg
ctcgcgcacgggctggtcgacgagttggccgccgaccgggacgccctgatggccgccgcc
cgtgagtggatcgccgcccacccggacgcgacccagccgtacgaccgcaaggactaccgg
atgcccggcggcaccccgtccagccccggcctcgcggtgcagttgccggccatgcccgcg
ctgctgcgcaagcagctcaaggacgcgccctacccggcgccccgcaacatcctcgccgcc
gccgtcgagggcgctcaggtggacctggacaccgcgttcgtcatcgaggggcggtacttc
accgagctggcgaccggccaggtcgccaagaacatgatcaaggcgctcttcttcgacctc
cagaccgcccggtcccgcaccgccggtggcgaccacgagccggtacgcagcgtcgccgtc
gccggcgcgggcatgatgggcgccgccatcgcgtacgtctgcgcccgcgccgggatgcgg
gtggtgctcaaggacgtcaccgccgagggcgcggcgcggggcaaggcgtactcggcgggc
ctgctcgacaaggcggtcgcgcggggccggtccacgccggagaagcgggacgagatcctg
ggccgcatccacgccaccggcgacctcgccgacctggccggcgtcgacctcgccatcgag
gcggtcttcgaggacccggcgctcaagcacaaggtgtacgccgagatcgagcaggtcgcg
ccggacgcgctcatcgcctccaacacctccacgctgcccatcacgctgctggccgagggc
gtcagccggccggaggagttcgtcgggctgcacttcttctccccggtggacaagatgccg
ctggtcgaggtgatccgcggggagcggaccgacgaggccacgctgggccgcgcgctgggc
gtcgtccgccagttgcgcaagacgccgatcgtggtcaacgacagccggggcttcttcacc
agccgggtcatcggcacgttcaccaacgagggcgtggcgatgctggccgagggcattccg
gcggcgaccatcgagcaggccagcagccaggccggctatcccgcgccggtcctcgcgctg
atggacgagctgaccctcaccctgccccggaagatccgccaggagacggccgccgcgaca
gtggccgccgggggcacctggcagccgcacgccgccgacgcggtgatcgaccggatgatc
gacgagtgcggccggaccggacgctccggcggtgccggcttctacgactaccgcgacggg
aagcgggccgggctctggccggggctgcgggagcagttcggcggcacgaacctggacacg
cccttcgaggacctcaaggagcggatgctcttcatcgaggcgatcgagtcggtgcggtgc
ctggaggagggcgtgctgacctcggtggccgacgccaacgtcggctcgatcctgggcatc
ggctacccgagctggaccggtggcgtcctgcagtacgtcaaccagtacgacggcgggctg
ccgggcttcgtggcccgtgcccgggtgctcgcagagcgctacggcgagcggttcgacccg
ccgccgctgctgacggccatggccgagcggggcgaacggttcgagtag

DBGET integrated database retrieval system