KEGG   Micromonospora sp. L5: ML5_2344Help
Entry
ML5_2344          CDS       T01379                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mil  Micromonospora sp. L5
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mil00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mil00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2437664..2439163
Genome map
AA seq 499 aa AA seqDB search
MSERTEGSTGDLAALAAAVLQPGFVGTTPPPWVCRWLGEGLGSVVLFARNVVDHEQVATL
TANLRAERPDVIVAIDEEAGDVTRIESARGSSRPGNYALGAVDDPALTEEVARDLGAELA
AVGVTLDYAPDADVNSNPANPVIGVRSFGADPDLVARHTAAWVRGLQAGGVAACAKHFPG
HGDTRVDSHHDLPRIGGDLARLDAVELAPFRAAVAAGVQAVMTGHLLVPALDPELPATLS
PRVLGGLLREEMGFGGVVVTDAVEMRAVADRYGFTGAAVRALVAGADAICVGGERATEAD
ARELRDAIVAAVISGELPEERLAEAAKRVGQLAAWSVAARARRAAGTPPADGSPIGLAAA
RRAVRVTGDAGLLPLTGPAHVVEFAPPRNIAIGEETPWGIAAPLAHLAPGTTTARYAADA
VPADPGATPAGRPLVLVVRDLHRHDWMRDAVRRALTARPDAVVVELGVPELVTGAVHLAT
HGATAAAARAAAEVLTGAR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggaccgagggatcgaccggagacctggcggcgctcgccgccgccgtcctg
caaccggggttcgtcggcaccacaccgccgccgtgggtgtgccgctggctcggcgagggc
ctcggctcggtggtcctgttcgcccgcaacgtcgtcgaccacgagcaggtcgccacgctc
accgcgaacctgcgcgccgagcggcccgacgtcatcgtggcgatcgacgaggaggccggc
gacgtcacccggatcgagtccgcccggggcagctcccgtcccggcaactacgcgctcggc
gctgtcgacgacccggcgctgaccgaggaggtcgcccgcgacctgggcgccgaactcgcg
gccgtcggcgtcacgctggactacgccccggacgccgacgtcaactccaacccggccaac
ccggtcatcggggtgcgctccttcggcgccgacccggacctggtcgcccggcacaccgcc
gcctgggtacgcggcctccaggccggcggcgtcgccgcctgcgccaagcacttccccggg
cacggcgacacccgtgtcgactcgcaccacgacctgccccgcatcggcggcgacctggcc
cgtctcgacgcggtcgagctggccccgttccgcgccgccgtggccgccggggtgcaggcg
gtgatgaccggtcacctgctggtgccggcgctggacccggagctgcccgccacgctcagc
ccgcgcgtgctcggcggcctgctgcgcgaggagatgggcttcggcggcgtggtggtcacc
gacgcggtggagatgcgcgcggtggccgaccggtacggcttcaccggcgccgccgtgcgc
gcgctcgtggccggcgcggacgcgatctgcgtcggcggggaacgggccaccgaggccgac
gcccgcgagctgcgcgacgcgatcgtcgcggcggtgatcagcggggagctgcccgaggag
cggctcgccgaggcggccaagcgcgtcggtcagctcgccgcgtggagcgtcgccgcccgc
gcccgccgggccgccggcacgccgcccgccgacggctcaccgatcgggctcgccgccgcc
cgccgcgcggtccgggtcaccggcgacgccgggctgctgccgctgaccggtccggcccac
gtcgtggagttcgcgcccccgcgcaacatcgccatcggcgaggagacgccgtggggcatc
gccgcaccgctggcccacctggcgcccggcaccaccaccgcccgctacgccgccgacgcc
gtaccggccgacccgggcgcgacgcccgccggccggccgctggtgctcgtggtgcgcgac
ctgcaccggcacgactggatgcgggacgcggtacgccgcgcgctcaccgcccgcccggac
gcggtggtggtcgagctgggcgtgcccgagctggtcaccggcgcggtgcacctggccacc
cacggcgccaccgccgcggcggcacgggccgccgccgaggtgctgaccggggcgcgctga

DBGET integrated database retrieval system