KEGG   Micromonospora sp. L5: ML5_2401Help
Entry
ML5_2401          CDS       T01379                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mil  Micromonospora sp. L5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mil00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ML5_2401
Enzymes [BR:mil01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ML5_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2496277..2496879
Genome map
AA seq 200 aa AA seqDB search
MIASVRGTVTATGPDHAVVEVGGIGLAVQCAPGTLADLRVGQPARLATSLVVREDSLTLY
GFADDDAKQLFELLQTASGVGPRLAQAVLAVHTPDAVRKAIANADTAALTRVPGIGKKGA
ERLVLELRDRVGPVPVGADGAAGVTAGAWPEQVRQALVGLGWTAGQAEQAVAAVAETVDG
ETPPVPVLLKQAIRLLGRNR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgagcgtacgcggcacggtgaccgccaccggcccggatcacgcggtggtggag
gtgggcggcatcggcctggccgtgcagtgcgctcccggcacgctcgccgacctgcgcgtg
ggccagcccgcccggctcgccaccagccttgtggtccgggaggactcgctcaccctctac
ggcttcgccgacgacgacgccaagcagctgttcgagctgctccagaccgccagcggggtc
ggtccccggctggcccaggcggtgctcgccgtgcacacgcccgacgcggtccgcaaggcc
atcgccaacgccgacaccgccgcgctgacccgggtgccgggcatcggcaagaagggtgcc
gagcggctggtgctggagctgcgcgaccgggtcggcccggtgccggtgggcgccgacggc
gcggccggggtgaccgcgggcgcctggccggagcaggtccgccaggccctcgtcgggctc
ggctggacggccgggcaggcggagcaggcggtggccgcggtggcggagaccgtcgacggc
gagaccccgccggtgccggtgctgctcaagcaggcgatccgcctcctgggccggaaccga
tga

DBGET integrated database retrieval system