KEGG   Micromonospora sp. L5: ML5_2453Help
Entry
ML5_2453          CDS       T01379                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mil  Micromonospora sp. L5
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ML5_2453
Enzymes [BR:mil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ML5_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2549172..2549723
Genome map
AA seq 183 aa AA seqDB search
MSTDDEARSAARLTVLSGPSGAGRSSVVEAVRARLASVCVPVVATTRPPRPDERDGVDRV
FLDAPGFDRLIAAGELLEWCRIGPYRRGVPRAEVRARLAEGRPVLLPLDLAGALAVRVAA
PGARLVLLAPPAYRADPDVAAIFAHAVAHDHTERAAAELVGLLGSSFLAPARPPAGGARD
AEV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacggatgacgaggcgcgctcggcggctcggctcactgtcctgtccggtccctcc
ggggccggccggagcagtgtcgtcgaggcggtccgggcgcgccttgcgtctgtctgcgtg
ccggtggtcgccaccacccgcccaccccgtccggacgagcgtgacggcgtcgaccgcgtc
ttcctcgacgcgcccggcttcgaccggctgatcgccgccggggagctgctggagtggtgc
cggatcgggccgtaccgccggggggtgccccgggccgaggtgcgggcgcggctcgcggag
ggacggccggtgctgctgccgctggacctggccggcgcgctggcggtacgggtggcggcg
cccggcgcccggctggtgctgctcgcgcccccggcgtaccgggccgacccggacgtcgcg
gccatcttcgcccatgccgtggcacacgaccacaccgagcgcgccgcggcggagctggta
ggattgctcggttcgtccttcctggctccggcccgaccgcccgcgggcggcgcacgagac
gcagaggtttaa

DBGET integrated database retrieval system