KEGG   Micromonospora sp. L5: ML5_2501Help
Entry
ML5_2501          CDS       T01379                                 

Definition
alcohol dehydrogenase groes domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mil  Micromonospora sp. L5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ML5_2501
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_2501
  Lipid metabolism
   00071 Fatty acid degradation
    ML5_2501
  Amino acid metabolism
   00350 Tyrosine metabolism
    ML5_2501
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ML5_2501
   00626 Naphthalene degradation
    ML5_2501
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ML5_2501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2597720..2598730)
Genome map
AA seq 336 aa AA seqDB search
MRASVVTAFDRPMEITERPVPEVGPGEILVRIEASGLCHTDIHAARGEWPVKPTPPFVPG
HEGVGLVEQVGPGVTEHAVGDRVALPWLGWACGTCKYCVTGWETLCESQRNTGYSIDGAH
AEYAVAAARYAVRVPDGVDPFEAAPLTCAGVTTYKAVKVAGVRPGERVAIFGIGGLGHLA
QQYAQIFGAETIAVDVTTEKLELATSLGAAHTVDAATTDPVERITALGGVDVAIVLAASP
RVIEQAHRSLRRGGRLVLVSLPADNAITLPVFETVLKGITVLGSIVGTRADLAEVFALHA
AGRTRVVYETRKLDDINDAVDDVLAGRVAARLVLQP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccagtgtcgtcaccgcgttcgaccgtccgatggagatcaccgagcgtcccgtg
ccggaggtcggcccgggcgagatcctggtccgcatcgaagccagcggactctgccacacc
gacatccacgccgcccgcggcgagtggccggtgaagcccactccgccgttcgtccccgga
cacgagggcgtcggcctggtcgagcaggtcggccccggcgtcaccgagcacgccgtcggc
gaccgcgtcgcgctgccctggctcggctgggcctgcggcacctgcaagtactgcgtgacc
ggctgggagacgctgtgcgagtcgcagcgcaacaccggctacagcatcgacggcgcgcac
gccgagtacgcggtcgccgccgcccggtacgcggtgcgcgtgcccgacggcgtggacccg
ttcgaggccgcgccgctgacctgcgcgggcgtcaccacgtacaaggccgtcaaggtcgcc
ggggtgcggccgggcgagcgggtcgcgatcttcggcatcggcggcctggggcacctcgcc
cagcagtacgcccagatcttcggcgccgagacgatcgcggtggacgtgaccaccgagaag
ctggaactggccacctcgctcggcgccgcgcacacggtcgacgccgccaccaccgacccg
gtcgagcggatcaccgcgctgggcggcgtggacgtggcgatcgtgctcgccgcgagccct
cgggtcatcgagcaggcgcaccgctcgctgcgccgcggcggccggctggtgctggtgtcg
ctgcccgccgacaacgcgatcaccctgcccgtcttcgagacggtactcaagggcatcacg
gtgctcggctcgatcgtcggcacccgcgccgacctggccgaggtcttcgcgctgcacgcc
gccggccgcacccgggtcgtctacgagacccgcaagctggacgacatcaacgacgcggtg
gacgacgtcctcgccggccgggtcgccgcccggctcgtgctccagccctga

DBGET integrated database retrieval system