KEGG   Micromonospora sp. L5: ML5_2545Help
Entry
ML5_2545          CDS       T01379                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
mil  Micromonospora sp. L5
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mil00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ML5_2545
DNA repair and recombination proteins [BR:mil03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ML5_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2654711..2655304
Genome map
AA seq 197 aa AA seqDB search
MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLAGALRKVKDLVRFCTTCY
NVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYHVLGGAINPLEGIGPDN
LRIRELMTRLGGGEVRELILATDPNTEGEATATYLALMVKPMGIAVTRLASGLPVGGDLE
YADEITLGRAFEGRRAV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggtgccatccaggatctgatcgacgagctgggccggttgccgggcgtgggc
ccgaagagcgcccagcggatcgcgttccacgtgctgtcggcggatccggccgacgtcaac
cggctggccggcgcgctgcgcaaggtcaaggacctggtccggttctgcacgacctgctac
aacgtggccgagtcggagcagtgccggatctgccgcgacccacggcgtaccgacgaggtg
ctctgtgtggtcgaggagccgaaggacgtggtggcgatcgagcggaccggcgagttccgc
gggcgctaccacgtgctcggcggcgcgatcaatccgctggagggcatcggcccggacaac
ctgcggatccgtgagctgatgacccgcctcggcggcggcgaggtccgcgagctgatcctc
gccaccgacccgaacaccgagggcgaggcgaccgccacctatctggcgctgatggtcaag
ccgatggggatcgcggtgacccggctcgcgagtggactgccggtcggcggcgacctggag
tacgccgacgagatcacgctgggccgggccttcgagggccgacgggccgtctga

DBGET integrated database retrieval system