KEGG   Micromonospora sp. L5: ML5_2610Help
Entry
ML5_2610          CDS       T01379                                 

Definition
GTP cyclohydrolase i (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mil  Micromonospora sp. L5
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ML5_2610
Enzymes [BR:mil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ML5_2610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2731607..2732224
Genome map
AA seq 205 aa AA seqDB search
MAARLISGKLTGGPVEDSVDLARIEKAVREILIAVGEDPDRDGLQQTPARVARAYAELFA
GLRVDPAQVLRTTFEANHEELVLVRDIDVMSLCEHHLLPFRGSAHIGYIPGPDGRITGLS
KLARLVEVFARRPQVQERLTSQIADLLMSSLAPRGVIVVLECEHMCMAMRGIQKSGAKTI
TSAVRGGLQNDAKSRAEAMALIMAR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgcctgatcagcggcaagctcaccggtggcccggtggaggacagcgtcgac
ctcgcccggatcgagaaggcggtccgcgagatcctcatcgctgtcggcgaggacccggac
cgtgacggcctccagcagacgcccgcccgggtcgcccgcgcgtacgccgaactcttcgcc
ggcctgcgggtcgaccccgcgcaggtgctccgcaccacgttcgaggccaaccacgaggag
ctggtgctcgtccgggacatcgacgtgatgagcctctgcgagcaccacctgctgccgttc
cggggcagcgcgcacatcggctacatccccggcccggacggccggatcaccggcctgtcc
aagctggcccggctggtcgaggtgttcgcccgccgaccgcaggtgcaggagcggctcacc
tcgcagatcgccgacctgctgatgtccagcctcgccccgcgcggcgtgatcgtggtgctg
gagtgcgagcacatgtgcatggcgatgcgcggcatccagaagtcgggcgcgaagaccatc
acgtccgccgtgcgcggcggactgcagaacgacgcgaagtcgcgggccgaggcgatggca
ctgatcatggcccgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system