KEGG   Micromonospora sp. L5: ML5_2621Help
Entry
ML5_2621          CDS       T01379                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mil  Micromonospora sp. L5
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ML5_2621
Enzymes [BR:mil01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ML5_2621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2745013..2746032
Genome map
AA seq 339 aa AA seqDB search
MRTSGVPRRALARWPEALPANGTVGSVTDLVRAETPVVMGVLNVTPDSFSDGGRYADLDA
AVAHGVRLRGEGADLIDVGGESTRPGAERVDAETETARVLPVVRELSAAGILVSIDTSRA
RVAEAVLAAGAYVVNDVSGGLADPDMARVVRDAGCPWVLMHWRGHSRGMRELATYTDVVA
EVRDELSRRVDAALAAGVAADRIIVDPGLGFAKTAAHNWALSARLPELVDLGFPVLFGAS
RKSYLGRLLADPAGEPRPTAGREAATVATSVLAVAAGAWGVRVHDVRGTADALAVWRATG
SPRLATATGPRQATAPRTAAAMGGTRPAEAATGTSGGDR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgtcaggggtgccgcgtcgggcgctcgcccggtggccggaagccctgccggcg
aacggtactgtcgggtccgtgaccgatctggtacgggcggagaccccggtggtgatgggc
gtcctcaacgtcacgcccgactccttctccgacggcggcagatacgccgatctggacgcg
gcagtcgcacacggggtgcgactgcgcggggaaggcgccgacctgatcgacgtgggtggc
gagtccacccggcccggcgccgagcgggtcgacgcggagacggagaccgcccgggtgctg
cccgtggtccgcgagctgagcgccgccggcatcctcgtcagcatcgacaccagccgcgcc
cgggtcgccgaggcggtcctcgccgccggcgcgtacgtggtcaacgacgtctccggcggc
ctcgccgacccggacatggcccgggtggtccgcgacgccggctgcccctgggtgctcatg
cactggcgggggcactcgcgggggatgcgggagctggccacctacaccgacgtggtggcc
gaggtccgggacgagctgagccggcgcgtcgacgccgcgctcgccgccggggtggccgcc
gaccggatcatcgtggacccgggcctgggcttcgcgaagaccgccgcgcacaactgggcg
ctgagcgcccgcctgcccgagctggtcgacctgggcttcccggtgctgttcggggccagc
cgcaagtcctacctgggccggctgctcgccgacccggccggcgaaccccgccccaccgcc
gggcgggaggccgcgaccgtcgcgacgagcgtgctcgccgtcgcggccggcgcctggggg
gtacgcgtgcacgacgtgcgcggcaccgccgacgcgctcgccgtctggcgtgccaccggc
agcccccggctcgccaccgcgaccggcccacggcaagcgacagcgccgcggaccgcagcg
gccatgggcggtacccggccggcggaagcggccaccggcacgagcggaggcgacagatga

DBGET integrated database retrieval system