KEGG   Micromonospora sp. L5: ML5_2623Help
Entry
ML5_2623          CDS       T01379                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mil  Micromonospora sp. L5
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mil00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2746385..2746912
Genome map
AA seq 175 aa AA seqDB search
MTRAVLSIGSNLGDRLGHLRGAVAAFGDRVLVVSGVYETPPWGDADQPAYLNAAVMVADP
AAAPEDWLARARAAEAAAGRDRDPQRRYGPRTLDVDVIAVWDDAGEPVLRDDPELILPHP
RAHLRAFVLRPWIDIEPHGRLPGHGWLTDLLNAEPLAGDALELSPRPDLALESDT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggccgtgctgtcgatcggcagcaacctgggcgaccgcctcggccacctgcgc
ggcgcggtggccgcgttcggcgaccgggtgctcgtggtctccggcgtctacgagactcca
ccgtggggggacgccgaccagcccgcgtacctgaacgccgcggtgatggtcgcggacccg
gcggcggcgccggaggactggctggcccgcgcccgggccgcggaggcggcggccgggcgc
gaccgcgacccgcaacgacggtacgggccgcgcacgctggacgtggacgtgatcgcggtc
tgggacgacgccggcgagccggtgctccgcgacgaccccgagctgatcctgccgcacccc
cgggcccacctgcgcgccttcgtgctgcgcccgtggatcgacatcgagccgcacggccgg
ctgcccgggcacggctggctgaccgatctgctcaacgccgagccgctcgccggggacgcc
ctggaactgagcccgcgacccgatctggcgctagagtcggacacatga

DBGET integrated database retrieval system