KEGG   Micromonospora sp. L5: ML5_2821Help
Entry
ML5_2821          CDS       T01379                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mil  Micromonospora sp. L5
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_2821
   01230 Biosynthesis of amino acids
    ML5_2821
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ML5_2821
  Energy metabolism
   00680 Methane metabolism
    ML5_2821
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML5_2821
Enzymes [BR:mil01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ML5_2821
Exosome [BR:mil04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ML5_2821
  Exosomal proteins of melanoma cells
   ML5_2821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
2952359..2953126
Genome map
AA seq 255 aa AA seqDB search
MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTTKGETEARRGGELLREHDLLPDV
VHTSLMRRAIRTAELALNAADRHWIAVRRSWRLNERHYGALQGKDKKQTLDEYGEEQFML
WRRSYDTPPPPIDDADEWSQVGDPRYALLPTELMPRTECLKDVVDRMLPYWYDSIVPDIL
AGRTVLVAAHGNSLRALVKHLDQISDDAIAKLNIPTGIPLRYDLDADLRPQVLGGTYLDP
DAAKAAAAAVANQGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgagcgaggggcccaccgtcgggacgctggtcctgctgcggcacggcgagagc
gactggaacgccaagaacctcttcaccggctgggtcgacgtcgacctgaccaccaagggg
gagaccgaggcgcggcgcggcggcgagctgctgcgcgagcacgacctgctgccggacgtg
gtgcacacgagcctgatgcgccgagccatccgcaccgccgagctggcgctgaacgccgcc
gaccggcactggatcgcggtacgccggtcgtggcggctcaacgaacgccactacggcgcc
ctgcagggcaaggacaagaagcagaccctcgacgagtacggcgaggagcagttcatgctc
tggcgccgctcgtacgacacgccgccgccgccgatcgacgacgcggacgagtggtcgcag
gtcggcgacccccggtacgcgctgctgccgaccgagctgatgccgcgcaccgagtgcctg
aaggacgtcgtcgaccggatgctgccctactggtacgactcgatcgtgccggacatcctg
gccggccggacggtgctggtggccgcgcacggcaactcgctgcgcgccctggtcaagcac
ctcgaccagatctccgacgacgcgatcgccaagctgaacatccccaccggcatcccgctg
cgctacgacctggacgccgacctgcggccgcaggtgctcggcgggacgtacctggacccg
gacgcggcgaaggctgccgccgccgcggtcgccaaccagggccgctga

DBGET integrated database retrieval system