KEGG   Micromonospora sp. L5: ML5_2857Help
Entry
ML5_2857          CDS       T01379                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mil  Micromonospora sp. L5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ML5_2857
Enzymes [BR:mil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ML5_2857
Exosome [BR:mil04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ML5_2857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2987479..2988462
Genome map
AA seq 327 aa AA seqDB search
MPYPEIRPRRLRRNAAVRRLVSETRVDPAELVVPMFVKEGLTEPRAIASLPGVLQHSRDS
LRKAAAEAVQAGVGGIMLFGVPATRDETGSGGIDPAGVLNTAIRDVVAEVGDSTVVMSDL
CLDEFTSHGHCGLLTPDGGVDNDATLAAYADMAVAQAAAGVHVVGPSGMMDGQVGVVRKA
LDAAGHQDVSVLAYAVKYASAFYGPFRDAVESALEGDRRTYQQDPANLRESLREVELDVA
EGADMVMVKPALPYLDVVSAVRDVVNVPVAAYQVSGEYAMVEAAAANGWIDRERVMLETL
TSIRRAGAQIILTYWAVEAAQLLRERY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccgtaccccgagatccggccccgccggctgcgccgcaacgcggccgtgcggcggctg
gtctccgagacccgcgtcgacccggccgagctggtcgtgccgatgttcgtcaaggagggg
ctgaccgagccgcgggccatcgcgtcgctcccgggggtgctccagcactcccgggactcg
ctgcgcaaggccgccgcggaggcggtccaggccggggtcggcgggatcatgctgttcggg
gtgccggcgacgcgggacgagaccggctccggtggcatcgacccggccggcgtgctcaac
acggcgatccgggacgtggtcgccgaggtcggcgactcgactgtggtgatgagcgacctg
tgcctggacgagttcacctcgcacgggcactgcggcctgctcaccccggacggcggggtc
gacaacgacgcgacgctcgccgcgtacgccgacatggcggtggcccaggccgccgccggg
gtccacgtggtcgggccgtccgggatgatggacggccaggtcggcgtggtccgcaaggcg
ctcgacgccgccgggcaccaggacgtctcggtgctcgcgtacgcggtgaagtatgcctcc
gccttctacggcccgttccgcgacgccgtggagtcggcgttggagggggaccggcgcacc
taccagcaggacccggcgaacctgcgcgagtcgctgcgcgaggtcgagctggacgtggcc
gagggcgccgacatggtgatggtcaagcccgcgctgccctacctcgacgtggtgtcggcg
gtccgtgatgtggtgaacgtcccggtcgccgcctaccaggtctccggcgagtacgcgatg
gtcgaggcggccgccgcgaacggctggatcgaccgggagcgggtgatgctggagacgctc
acctcgatccgccgggccggcgcccagatcatcctcacctactgggccgtcgaggccgcc
cagttgctgcgcgagcgttactga

DBGET integrated database retrieval system