KEGG   Micromonospora sp. L5: ML5_2922Help
Entry
ML5_2922          CDS       T01379                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mil  Micromonospora sp. L5
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_2922
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ML5_2922
Enzymes [BR:mil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ML5_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3063205..3064362)
Genome map
AA seq 385 aa AA seqDB search
MGTRRGAADRSAQNGRVREAVTSARRIVVKIGSSSLTTATGGLDDARVDALVDTLGGLAA
SGREVVLVSSGAIAAGLAPLRLPRRPRDLATQQAAASVGQGLLIGRYAAAFARHGRTVGQ
VLLTVDDVTRRAHYRNAYRTLRKLLDLHAVPIVNENDTVATEEIRFGDNDRLAALVAALV
DADLLVLLSDVDALWTGDPARPGSTRITEVHGEGDLAGVDVGGAGRAGVGTGGMVTKVEA
ARIATGFGIPVVLTAAPLAAPALAGEPVGTYFHPSSRRPAARLFWLAHATAPRGRLHLDP
GAVQAVVGRRKSLLPAGITAVDGAFTAGDPVDLVDTAGAPVARGLVNYDAVELPGLLGRS
TSELAAALGPAYEREVVHRDDLVLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgcgccgcggcgcggcagaccgcagcgcgcagaatggtcgggtgcgcgaagca
gtcacctcggcccggcggatcgtggtcaagatcggttcgtcctcgctgaccaccgcgacg
ggcggcctcgacgacgcccgggtcgacgcgctcgtcgacacgctcggcgggctcgccgcc
tccggacgcgaggtggtgctggtctcctccggcgcgatcgccgccgggctcgccccgctg
cggctgccccggcgcccgcgcgaccttgccacccagcaggccgccgccagcgtcggccag
ggcctgctgatcggccggtacgcggccgcgttcgcccggcacggccgcaccgtcgggcag
gtgctgctcaccgtggacgacgtgacacggcgggcccactaccgcaacgcgtaccggacg
ctgcgcaagctgctcgacctgcacgcggtgccgatcgtcaacgagaacgacacggtggcc
accgaggagatccggttcggcgacaacgaccgcctggccgcgctcgtcgccgcgctcgtc
gacgccgacctgctggtgctgctctccgacgtcgacgcgctctggaccggcgacccggcc
cgcccgggcagcacccgcatcaccgaggtgcacggcgagggcgacctggcgggcgtggac
gtgggcggggccggccgggccggggtgggcaccggcggcatggtgacgaaggtcgaggcg
gcccggatcgccaccggcttcggcatcccggtggtgctgaccgccgcgccgctggccgcg
ccggcgctggccggggagccggtcggcacgtacttccacccgagcagccgccgccccgcc
gcccgtctgttctggctggcgcacgccaccgccccccgcggccgcctgcacctcgacccg
ggcgcggtgcaggcggtggtcggccgccgcaagtcgctgctgcccgccggcatcaccgcc
gtcgacggcgcgttcaccgcgggcgacccggtggacctggtcgacaccgccggcgcgccg
gtggcccgagggctggtcaactacgacgcggtggagctgccggggctgctcggccgttcc
acctccgaactcgccgcggcgctcggcccggcgtacgaacgcgaggtcgtccaccgcgac
gacctggtcctgctgtaa

DBGET integrated database retrieval system