KEGG   Micromonospora sp. L5: ML5_3021Help
Entry
ML5_3021          CDS       T01379                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mil  Micromonospora sp. L5
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mil00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3170586..3172100)
Genome map
AA seq 504 aa AA seqDB search
MDARGGYGAAVTAEFVAAIDQGTTSSRCIVFDRAGEIVAVAQREHRQIFPRPGWVEHDAE
EIWTNVEHVVREALASADIGTESLAAVGITNQRETTVVWDRETGRPVANAIVWQDTRTGP
LLRELTEAYDEERLRARTGLTPATYFAGPKLRWLLDNVDGLRERAERGEVLFGTMDSWLI
WKLTGRHVTDVTNASRTMLMDLETLDWAPELLDALRVPAAVLPEIRSSAEVYGTAQGVLA
GVPVASALGDQQAALFGQTCFQPGEAKCTYGTGSFLLLNTGASPVPSRHGLLTTVAYRIE
GQPAVYALEGAIAVTGSLVQWLRDNLGLISSAPQVEELARTVDDNGGCYVVPAFSGLFAP
HWRSDARGVIAGLTGYITKGHLARAVLEASAFQTREVVDAMNADSDVALRRLRVDGGMTG
NELLMQFLADVLDVPVVRSRITETTCLGAAYAAGLAVGFWPDLATLREKWRSDAQWESTM
DPAHREQEMRQWRKAVRRTLDWVD
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggacgctcgcggcgggtacggtgctgccgtgaccgcagagttcgtcgccgccatcgac
cagggcaccacgtcctcgcgctgcatcgtcttcgaccgggccggcgagatcgtcgccgtg
gcccagcgcgagcaccggcagatcttcccccggcccggctgggtggagcacgacgccgag
gagatctggacgaacgtcgagcacgtggtgcgcgaggcgctggccagcgccgacatcggc
accgagtcgctggccgcggtgggcatcaccaaccagcgcgagaccactgtggtgtgggac
cgggagaccggccgtccggtggcgaacgccatcgtctggcaggacacccgcaccggcccg
ctgctgcgggagctgaccgaggcgtacgacgaggagcggctgcgggcccgcaccggcctg
accccggccacctacttcgccggcccgaagctgcgctggctgctcgacaacgtcgacggg
ctgcgcgagcgggccgagcgcggcgaggtgctgttcggcaccatggacagctggctgatc
tggaagctgaccggccggcacgtcaccgacgtgacgaacgccagccgcaccatgctgatg
gacctggagacgctcgactgggccccggagctgctcgacgcgctgcgcgtcccggccgcc
gtgctgccggagatccgcagctcggccgaggtgtacggcaccgcccagggggtgctggcc
ggggtgccggtggcgagcgcgctcggcgaccagcaggcggccctgttcgggcagacctgt
ttccagcccggcgaggccaagtgcacctacggcaccggcagcttcttgctgctcaacacc
ggcgccagcccggtgccgtcgcggcacggcctgctcaccaccgtggcgtaccggatcgag
ggccagcccgccgtgtacgcgctggagggtgccatcgcggtcaccggctcgctcgtgcag
tggctgcgcgacaacctcggcctgatctcctccgccccgcaggtcgaggagctggcccgc
accgtcgacgacaatggcggctgctacgtggtgccggccttctccggcctgttcgccccg
cactggcgcagcgacgcccggggcgtgatcgccgggctgaccggctacatcaccaagggg
cacctggcccgcgcggtgctggaggcgtcggccttccagacccgggaggtggtggacgcg
atgaacgccgactccgacgtggcgctgcgccggctgcgggtcgacggcgggatgaccggc
aacgagctgctgatgcagttcctcgccgatgtgctcgacgtgccggtcgtgcggtcccgg
atcaccgagacgacctgcctcggcgccgcgtacgccgccggcctggccgtcgggttctgg
ccggacctggccacgctgcgcgagaagtggcgatcggacgcgcagtgggagtcgaccatg
gacccggcgcaccgggagcaggagatgcgccagtggcgcaaggcggtgcggcgcacgctc
gactgggtcgactga

DBGET integrated database retrieval system