KEGG   Micromonospora sp. L5: ML5_3210Help
Entry
ML5_3210          CDS       T01379                                 

Definition
crotonyl-CoA reductase
Orthology
K17829  
crotonyl-CoA reductase [EC:1.3.1.86]
Organism
mil  Micromonospora sp. L5
Pathway
Butanoate metabolism
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_3210
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ML5_3210
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.86  crotonyl-CoA reductase
     ML5_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3368431..3369786)
Genome map
AA seq 451 aa AA seqDB search
MQDILEAIMAAEGSSQPERELAGLAGLPVPESYRGVVVRAEDTRMFEGMATRDKDPRKAL
HVQEVPTPELGPGEALVAVMASAINYNTVWTSIFEPLPTFKFLQRYGRLSELTRRHDLPY
HVVGSDAAGVVLRTGPGVTKWKAGDEVVAHCLSVELEDSAGHDDTMLDPQQRIWGFETNF
GGLAELAIVKANQLMPKPRHLSWEEAASPGLVNSTAYRQLVSHHGANMKQGDVVLIWGAS
GGLGGYATQMALNGGAIPVCVVSSPEKAELCRKMGAELVIDRTAEGFKFWSDEQTQDQDE
WRRFGERIRELTGGEDPDIVFEHPGRETFGASVYVAKKGGTIVTCASTSGFNHQYDNRYL
WMHLKRIVGSHFANYHEAWQANRLVALGKVHPTVSKTYALEQTGQAAYEVHRNAHQGKVG
VRCLAPTDGLGVRDIEMRSRHESAINRFRGH
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggacatcctcgaagcgatcatggcggcggagggttcgtcgcagccggagcgggag
ctcgccggcctcgccggactgcccgtgccggagagctaccggggcgtggtggtgcgcgcc
gaggacacccgcatgttcgagggcatggccacccgcgacaaggacccgcgcaaggcgctg
cacgtgcaggaggtgcccacccccgagctgggcccgggtgaggcgctcgtcgcggtgatg
gccagcgcgatcaactacaacacggtgtggacgagcatcttcgagccgctgccgaccttc
aagttcctccagcgctacggccggctctccgagctgacccgccgccacgacctgccgtac
cacgtggtcggctcggacgccgcgggcgtggtgctgcgtaccgggccgggcgtgaccaag
tggaaggccggcgacgaggtggtcgcgcactgcctctcggtcgagctggaggactccgcc
ggccacgacgacacgatgctcgacccgcagcagcggatctggggcttcgagaccaacttc
ggcggcctggccgagctggcgatcgtcaaggccaaccagctgatgccgaagccgcgccac
ctgagctgggaggaggcggccagcccggggctggtcaactccaccgcgtaccggcagctc
gtctcgcaccacggcgcgaacatgaagcagggcgacgtggtgctgatctggggcgcctcc
ggcggcctcggcgggtacgccacccagatggccctcaacggcggcgcgatcccggtctgc
gtggtctcctccccggagaaggccgagctgtgccggaagatgggcgccgaactggtcatc
gaccgtaccgccgagggattcaagttctggtccgacgagcagacccaggaccaggacgag
tggcggcgcttcggtgagcgcatccgcgagctgaccggcggcgaggacccggacatcgtc
ttcgagcacccgggccgggagacgttcggcgccagcgtctacgtcgccaagaagggcggc
acgatcgtcacctgcgcctccaccagcggcttcaaccaccagtacgacaaccgctacctg
tggatgcacctcaagcggatcgtcggcagccacttcgccaactaccacgaggcgtggcag
gccaaccggctggtcgcgctcggcaaggtgcacccgaccgtgtcgaagacatacgcgctg
gagcagaccggccaggccgcgtacgaggtgcaccgcaacgcgcaccagggcaaggtcggc
gtgcggtgcctcgcccccaccgacgggctcggcgtccgcgacatcgagatgcgttcgcgc
cacgaaagcgccatcaaccggttccgcggtcactga

DBGET integrated database retrieval system