KEGG   Micromonospora sp. L5: ML5_3223Help
Entry
ML5_3223          CDS       T01379                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mil  Micromonospora sp. L5
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mil01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mil00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3384883..3386127
Genome map
AA seq 414 aa AA seqDB search
MTSDTHASLRAGHLVDEQAVVSLTQDLVRIPSTWDAGRGRSEQPVAELVAQVMRGFGWRP
EVTEVVPGRPNVVAVVDGGLPGPTLMFEGHTDVVTEGAPEEWTVDPFGGDIVDGRLYGRG
SADMKAGVAAMIHATRAVELAGPFPGRIVVAALVDEEGQMLGAKHFTTTALAREVDAAII
CEPEAEEICAVAKGAVRLLVTCTGKMAHGAMPQHGRNPVPAVAELVAALGRYQKELQADP
GEHEHLGLTYLTPTVLDAGSADQLNVIPGRAVLGVDCRTVPGVDHAALAARVRSDADAIG
TRHGVTFAVEVVDDRPCAVTPEDHPVSLAVAEAHRAVTGAEPVFGGVPGATDGTILWRDS
GIPNVVYGPGPKWIAHQPDEYVEVDDVVRKTKVYAEAALAFLTGATGALTGAAS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggacacccacgcctccctccgcgccggccatctcgtggacgaacaagccgtc
gtgtcgctcacccaggacctggtccgcatcccctcgacctgggacgcgggccgagggcgt
agcgagcagccagtggcggaactcgtcgcgcaggtcatgcggggattcggctggcggccg
gaggtcaccgaggtcgtccccgggcgccccaacgtcgtcgcggtggtggacggcggcctg
cccggcccgacgctgatgttcgaggggcacaccgacgtcgtcaccgagggcgctcccgag
gagtggaccgtcgacccgttcggcggcgacatcgtcgacgggcggctgtacggtcgcggc
tccgccgacatgaaggccggtgtcgccgcgatgatccacgcgacccgggccgtcgagctg
gccgggccgttcccgggccggatcgtggtggcggccctggtggacgaggagggccagatg
ctcggggcgaagcacttcaccaccaccgcgctcgcccgcgaggtggacgccgcgatcatc
tgtgagccggaggcggaggagatctgcgcggtcgccaagggcgccgtccggctgcttgtc
acctgcaccggcaagatggcgcacggcgcgatgccgcagcacggccgcaaccccgtgccg
gcggtggccgagctggtcgccgcgctcggccggtaccagaaggagctgcaggccgacccg
ggtgagcacgagcacctcggcctgacgtacctgacccccacggtcctggacgccggctcc
gccgaccagctcaacgtcatccccggccgcgccgtcctcggcgtggactgccggaccgta
cccggtgtcgaccacgccgcgctcgccgcgcgcgtccgctccgacgccgacgccatcggc
accaggcacggcgtcaccttcgccgtcgaggtcgtcgacgaccggccgtgcgcggtcacc
ccggaggaccaccccgtctcgctcgccgtggccgaggcgcaccgcgccgtcaccggcgcc
gagcccgtcttcggcggcgtgcccggcgcgaccgacggcaccatcctgtggcgcgacagc
ggcatcccgaacgtggtgtacggacccggcccgaagtggatcgcccaccagcccgacgag
tacgtcgaggtcgacgacgtcgtccgcaagacgaaggtatacgccgaggcggccctggcc
ttcctcaccggggccaccggcgccctgacgggtgcggcgtcgtga

DBGET integrated database retrieval system