KEGG   Micromonospora sp. L5: ML5_3240Help
Entry
ML5_3240          CDS       T01379                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mil  Micromonospora sp. L5
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ML5_3240
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ML5_3240
Enzymes [BR:mil01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ML5_3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3406084..3407253
Genome map
AA seq 389 aa AA seqDB search
MMRRIAVLDAPTNLGLRPPTASSVPGCGKAPGALRDHGLLARLRARDAGCLTPPRYDPGD
WRPGDGVCHAPEISAYSVALADRIGAIIDRGEFPLVLGGDCSVLLGSALAMHRLGEAVGG
RIGLVFVDGHSDFRHPGNASYVGAAAGEDLALVTGRGQPDLAAIEGRRPYFRDIDVVVLG
IRAQDEYRLDLQAAGITTRPVPALRAEGAARTAQWAHEQLVDCAGYWVHIDVDVLDPAVM
PAVDAPDPGGIAFAELEILLAGLVDTPHCLGVELTVFDPDYDPDGAYAAEIVNTVVAGLA
PVVAPGAVPPRLLPAGPVAPAPRAADSRPEPEPLPAPAAVPAPAVAVEPIGPDPTADDDL
GDDPLGPGLLRRAPTGDEPDPARSGIDIA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgccggatcgccgtcctcgacgcgccgacgaacctcggactgcgcccgcccacc
gcgagctccgtccccgggtgcggcaaggcgcctggtgcgctgcgcgaccacggcctgctc
gcgcggctgcgggcccgcgacgccggctgcctcaccccgccccggtacgacccgggcgac
tggcggcccggcgacggcgtctgccacgcgccggagatctccgcgtactcggtggcgctc
gccgaccggatcggcgcgatcatcgaccggggcgagttcccgctggtgctcggcggtgac
tgctcggtgctgctcggctcggcgctggccatgcaccgcctcggcgaggcggtcggcggg
cggatcgggctggtgttcgtcgacggccactccgacttccggcaccccggcaacgcctcc
tacgtcggcgctgccgccggggaggacctggccctggtgaccggccggggacagcccgac
ctggccgcgatcgagggccgcaggccgtacttccgggacatcgacgtggtggtgctcggc
atccgcgcgcaggacgagtaccggctcgacctccaggccgccggcatcaccacccggccg
gtgccggcgctgcgcgccgagggcgccgcccgtaccgctcagtgggcgcacgagcagctc
gtcgactgcgccggctactgggtgcacatcgacgtggacgtgctcgacccggcggtgatg
cccgccgtggacgcgcccgacccgggcggcatcgccttcgccgagctggagatcctgctc
gccgggctggtcgacaccccgcactgcctcggcgtcgagctgaccgtgttcgaccccgac
tacgacccggacggggcgtacgcggccgagatcgtgaacacagtggtggccgggctcgcc
cctgtggtcgcgccgggcgccgtgccgccccggttgctgccggccgggcctgtcgcaccg
gcgccccgcgccgccgacagccggccggagcccgagccgctgcccgccccggcggccgta
ccggcgccggcggtcgcggtggagccgatcggccccgacccgacggccgacgacgatctc
ggcgacgacccgctggggcccggcctgctgcgccgcgcccccaccggagacgagccggac
ccggcccgctccggcatcgacatcgcctga

DBGET integrated database retrieval system