KEGG   Micromonospora sp. L5: ML5_3263Help
Entry
ML5_3263          CDS       T01379                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mil  Micromonospora sp. L5
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ML5_3263
   00051 Fructose and mannose metabolism
    ML5_3263
Enzymes [BR:mil01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ML5_3263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3438259..3439446
Genome map
AA seq 395 aa AA seqDB search
MAPRPTPADKFSFGLWTVGWPARDPFGDATRPELDAVEAVHRLAELGVYGITFHDDDLVP
FGADAATRDARLSRFRKALDETGLVVPMVTTNLFNHPVFKDGGFTSNDRDVRRYALRKVL
RNIDLAAEMGAKTFVMWGGREGAEYDVAKDVQAALDRYREAVDLLCEYVVDNGYDLRFAL
EPKPNEPRGDILLPTVGHALGFISTLARPEMVGLNPEVGHEQMAGLNFAHGIAQALWQGK
LFHIDLNGQRGIKYDQDLVFGHGDLLNAFALVDLLEHGGPNGGPAYDGPRHFDYKPSRTE
DMTGVWASAEANMRTYLLLKERAAAFRADPEVVEALAAARVAELATPTLNPGEGYRELLA
DRTAFEEFDPEAAGAKGFGFVRLNQLAVEHVLGAR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaccccgccccacccccgcggacaagttctccttcggtctctggacggtgggctgg
ccggcccgtgacccgttcggtgacgccacccggcccgagctggacgccgtcgaggcggtg
caccggctcgccgagctgggcgtgtacggcatcaccttccacgacgacgacctggtcccg
ttcggcgcggacgccgccacccgcgacgcccggctgagccgcttccgcaaggccctcgac
gagaccggcctggtcgtgccgatggtcaccaccaacctgttcaaccacccggtgttcaag
gacggcggcttcaccagcaacgaccgcgacgtgcgccggtacgcgctgcgcaaggtgctg
cgcaacatcgacctggccgccgagatgggcgcgaagacgttcgtcatgtggggcggccgg
gagggcgccgagtacgacgtggcgaaggacgtccaggccgcgctggaccgctaccgcgaa
gccgtcgacctgctctgcgagtacgtcgtcgacaacggctacgacctgcgcttcgcactg
gagcccaagccgaacgagccgcgcggcgacatcctgctgcccacggtcggccacgcgctc
gggttcatctccacgctggcccgcccggagatggtcgggctcaacccggaggtcgggcac
gagcagatggccgggctgaacttcgcccacggcatcgcccaggcgctctggcagggcaag
ctgttccacatcgacctcaacggccagcgcggcatcaagtacgaccaggacctggtcttc
ggccacggcgacctgctcaacgcgttcgccctggtcgacctgctggagcacggcggcccg
aacggcggcccggcctacgacggcccgcgccacttcgactacaagccgtcccgcaccgag
gacatgaccggcgtgtgggcctccgccgaggcgaacatgcggacgtacctgctgctcaag
gagcgggccgcggcgttccgcgccgacccggaggtggtcgaggcgctcgccgccgcccgg
gtggccgagctggccaccccgacgctcaaccccggtgagggctaccgcgagctgctggcc
gaccggaccgcgttcgaggagttcgacccggaggccgccggggcgaagggcttcggcttc
gtccggctcaaccagctcgccgtcgagcacgtgctcggcgcgcgctga

DBGET integrated database retrieval system