KEGG   Micromonospora sp. L5: ML5_3356Help
Entry
ML5_3356          CDS       T01379                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mil  Micromonospora sp. L5
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mil00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mil00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mil00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mil00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mil00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3525314..3526249
Genome map
AA seq 311 aa AA seqDB search
MTVGVAVLGSGNIGTDLMIKVLRLSESLRMVAMAGIDPASDGLARARRLGVTTTAEGVDG
LVALPEFADVQLVFDATSAGAHKRHDEVLRAHGRTVVDLTPAAIGPYVVPPVNLDEHLGE
PNVNMVTCGGQATVPIVHAVGRVTPVAYGEIVASIASKSAGPGTRANIDEFTETTARAIE
VVGGAERGKAIIVLNPADPPLLMRDTVYCLCPDADADRGAIAASVADMVKAVQEYVPGYR
LKQDVQFDAVDTYAPVLGRHFTGLQVSVFLEVSGAGHYLPAYAGNLDIMTSAALRTAERL
VALRSPEVSAR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcggagtggcggtgctcgggtcgggcaacatcggcaccgacctgatgatcaag
gtgttgcggctcagtgagagcctgcgcatggtggcgatggccggcatcgacccggcctcg
gacggtctggcccgggcccgccggctcggcgtgaccaccaccgccgagggcgtcgacggc
ctcgtggcgctgcccgagttcgcggacgtccagctcgtcttcgacgccacctcggccggc
gcgcacaagcgtcacgacgaggtgctgcgggcgcacggccgtaccgtcgtcgacctgacg
cccgcggcgatcggcccgtacgtggtgccgccggtgaacctcgacgagcacctgggcgag
ccgaacgtcaacatggtgacctgcggcggccaggccacggtgccgatcgtgcacgcggtc
ggccgggtcacccccgtcgcgtacggcgagatcgtcgcctcgatcgcctcgaagtcggcc
gggcccggcacccgggccaacatcgacgagttcaccgagaccaccgcccgcgccatcgag
gtggtcggcggcgccgagcgcggcaaggccatcatcgtgctgaacccggccgacccgccg
ctgctcatgcgtgacacggtctactgcctgtgcccggacgccgacgccgaccggggcgcg
atcgccgcctcggtggccgacatggtgaaggccgtgcaggagtacgtgcccggctaccgg
ctcaagcaggacgtgcagttcgacgccgtggacacgtacgcgccggtgctgggccggcac
ttcaccggcctccaggtgtcggtgttcctggaggtctccggcgccgggcactacctgccc
gcgtacgccgggaacctggacatcatgacgtcggccgcgctgcgtaccgcggagcggctg
gtggcgctgcgttccccggaggtgagtgcccgatga

DBGET integrated database retrieval system