KEGG   Micromonospora sp. L5: ML5_3356Help
Entry
ML5_3356          CDS       T01379                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mil  Micromonospora sp. L5
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ML5_3356
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ML5_3356
   00650 Butanoate metabolism
    ML5_3356
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ML5_3356
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML5_3356
   00622 Xylene degradation
    ML5_3356
   00621 Dioxin degradation
    ML5_3356
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ML5_3356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3525314..3526249
Genome map
AA seq 311 aa AA seqDB search
MTVGVAVLGSGNIGTDLMIKVLRLSESLRMVAMAGIDPASDGLARARRLGVTTTAEGVDG
LVALPEFADVQLVFDATSAGAHKRHDEVLRAHGRTVVDLTPAAIGPYVVPPVNLDEHLGE
PNVNMVTCGGQATVPIVHAVGRVTPVAYGEIVASIASKSAGPGTRANIDEFTETTARAIE
VVGGAERGKAIIVLNPADPPLLMRDTVYCLCPDADADRGAIAASVADMVKAVQEYVPGYR
LKQDVQFDAVDTYAPVLGRHFTGLQVSVFLEVSGAGHYLPAYAGNLDIMTSAALRTAERL
VALRSPEVSAR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcggagtggcggtgctcgggtcgggcaacatcggcaccgacctgatgatcaag
gtgttgcggctcagtgagagcctgcgcatggtggcgatggccggcatcgacccggcctcg
gacggtctggcccgggcccgccggctcggcgtgaccaccaccgccgagggcgtcgacggc
ctcgtggcgctgcccgagttcgcggacgtccagctcgtcttcgacgccacctcggccggc
gcgcacaagcgtcacgacgaggtgctgcgggcgcacggccgtaccgtcgtcgacctgacg
cccgcggcgatcggcccgtacgtggtgccgccggtgaacctcgacgagcacctgggcgag
ccgaacgtcaacatggtgacctgcggcggccaggccacggtgccgatcgtgcacgcggtc
ggccgggtcacccccgtcgcgtacggcgagatcgtcgcctcgatcgcctcgaagtcggcc
gggcccggcacccgggccaacatcgacgagttcaccgagaccaccgcccgcgccatcgag
gtggtcggcggcgccgagcgcggcaaggccatcatcgtgctgaacccggccgacccgccg
ctgctcatgcgtgacacggtctactgcctgtgcccggacgccgacgccgaccggggcgcg
atcgccgcctcggtggccgacatggtgaaggccgtgcaggagtacgtgcccggctaccgg
ctcaagcaggacgtgcagttcgacgccgtggacacgtacgcgccggtgctgggccggcac
ttcaccggcctccaggtgtcggtgttcctggaggtctccggcgccgggcactacctgccc
gcgtacgccgggaacctggacatcatgacgtcggccgcgctgcgtaccgcggagcggctg
gtggcgctgcgttccccggaggtgagtgcccgatga

DBGET integrated database retrieval system