KEGG   Micromonospora sp. L5: ML5_3401Help
Entry
ML5_3401          CDS       T01379                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mil  Micromonospora sp. L5
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mil00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mil00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mil02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3575302..3576861
Genome map
AA seq 519 aa AA seqDB search
MTHFDRRTLLRAGLVAGAGVAGGALLGAPGAPAAPGLRRSGRPLLTHGVQSGDVTADSAL
VWTRADRPGRMLVEVSRRPDLRGARLVRGPVVDPTGDLTGKVRLRGLPAGERLHYRVRVE
SLDRHGLCSEPLTGSFATAPGRHQRRDVRFVWTGDIVGQGWGISPDFDGLAIFRAMRERR
PDFFLCSGDTVYADGPLTESVVLPDGRTWRNLVTPEKSKVAETLAEYRGQFAYNLLDEHL
RAFAAQVPQINQWDDHEVVNNWYPGEILTDERYGEKRVDVLAARARQAFHEWLPVPSGGP
MYRKLSYGPLLDVFVLDMRTYKDPNDGNTYADRNRGLLGKAQREWLIRELRASRATWKVI
ANDLPIGLVVPDGSAAQEGVAQGDHGAPAGRELEFAEVLRASHRAGVTGLVFLTADVHYT
AAHHYDPARAAVRDFSPFWEFVSGPAHAGAFGPNALDGTFGPKAVFVHAPPRANTSPAEG
FQHFGEVTIDGPSRALTVHLRDRTGASLWTTTLPAPTSR
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacttcgatcgacgtaccctgctccgcgccggcctggtcgccggtgccggagtc
gccggcggcgcgctgctcggcgcgcccggcgcgcccgccgcacccggcctgcggcgcagc
ggccggccgctgctcacccacggcgtgcagagcggcgacgtgaccgccgactcggcgctg
gtctggacccgcgcggaccggcccggccggatgctggtcgaggtcagccgccggccggac
ctgcgcggcgcccgcctggtgcgcggcccggtggtcgaccccaccggcgacctcaccggc
aaggtccgcctgcgcggcctgcccgcgggggagcggctgcactaccgggtacgggtggag
agcctggaccggcacggcctgtgcagcgagccgctgaccggttcgttcgccaccgccccc
gggcggcaccagcggcgtgacgtgcggttcgtgtggaccggcgacatcgtcgggcagggc
tgggggatcagccctgacttcgacggcctggcgatcttccgggccatgcgggagcgccgc
ccggacttcttcctgtgcagcggcgacaccgtgtacgccgacgggccgctgaccgagagc
gtggtcctgcccgacggccggacctggcgcaacctggtgacgccggagaagagcaaggtg
gccgagacgctcgccgagtaccgggggcagttcgcgtacaacctgctcgacgagcacctg
cgggcgttcgccgcccaggtgccgcagatcaaccagtgggacgaccacgaggtggtgaac
aactggtacccgggggagatcctgaccgacgagcggtacggcgagaagcgcgtggacgtg
ctcgccgcccgggcccggcaggcgttccacgagtggctgccggtgccgtcgggcgggccg
atgtaccgcaagctgtcgtacgggccgctgctggacgtgttcgtgctggacatgcgcacc
tacaaggaccccaacgacggcaacacgtacgccgaccgcaaccggggcctgctcggcaag
gcgcagcgggagtggctgatccgggagctgcgcgcgtcccgggccacctggaaggtgatc
gccaacgacctgccgatcggcctggtggtgccggacggttccgccgcgcaggagggcgtc
gcgcagggcgaccacggcgcgccggccggccgggagttggagttcgccgaggtgctgcgc
gcctcgcaccgggccggggtgaccgggctggtgttcctcaccgccgacgtgcactacacc
gccgcccaccactacgacccggcgcgcgccgcggtgcgggacttcagcccgttctgggag
ttcgtctccggcccggcgcacgccggcgcgttcggcccgaacgcgctggacggcacgttc
ggcccgaaggcggtgttcgtgcacgccccgccgcgcgcgaacacctccccggccgagggc
ttccagcacttcggcgaggtgaccatcgacggcccgtcgcgggccctcacggtccacctc
cgcgaccgcaccggcgcctccctctggaccaccaccctccccgcccccacctcccgctga

DBGET integrated database retrieval system