KEGG   Micromonospora sp. L5: ML5_3700Help
Entry
ML5_3700          CDS       T01379                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, e2 component, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mil  Micromonospora sp. L5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_3700
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML5_3700
  Amino acid metabolism
   00310 Lysine degradation
    ML5_3700
Enzymes [BR:mil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ML5_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(3890576..3892417)
Genome map
AA seq 613 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLSRIV
VGEDETAEVGSELAVIAGEGEDAGAAPTEKAEPATEPTAAAEGTGPEPEQAQEAEEAAAE
PGAEAEQPAVEEPAEPAAPSGEGTPVTMPALGESVTEGTVTRWLKQVGETVEVDEPLLEV
STDKVDTEIPSPVAGTLQEIKVAEDETADVGAVLAIVGVAGAAPAKAEPKPEPKPEPKAE
AKPEPKPEPKVEEPTPGASYNEPAAEAEQAAQPAKAEQAAQPAAPAAAQRPSVPSEYGED
AAGYVTPLVRKLAAEHGVDLGSIKGTGVGGRIRKQDVLEAAEKAKAAKPAPAAAAAPSAP
APAKPAAKPEPSAKRGTTEKLPRIRSIIAKRLQQSLHETAQLTTVVEVDVTKVAKLRARA
KDSFQAKHGVKLSFLPFFAVAAIEALQTYPIIQASMDLDGGTITYPGAEHLGIAVDTERG
LLTPVIHNAGDLNMGGLAKRIADLAERTRANKITPDEMAGATFTLTNTGSRGALFDTPIV
PSPQSAMLGTGAVVKRPVVVNDAELGEVVAIRSMVYLALSYDHRLIDGADAARFLTAVKE
RLEGGNFEAELGL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggcgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggtgacaccgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtcccccgcggcgggcgtgctgagccggatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcggtcatcgccggcgagggc
gaggacgcgggcgcggctcccacggagaaggccgagccggccaccgagccgacggccgcc
gccgagggcaccggccccgagccggagcaggcccaggaggccgaggaggccgccgccgag
ccgggcgccgaggccgagcagccggccgtcgaggagccggccgagcccgccgcgccgtcg
ggcgagggcacgccggtgaccatgccggccctgggcgagagcgtcaccgagggtactgtc
acccgctggctcaagcaggtcggcgagaccgtcgaggtggacgagccgctgctggaggtc
tccaccgacaaggtcgacaccgagatcccgtcgccggtcgccggcacgctgcaggagatc
aaggtcgccgaggacgagaccgccgacgtcggcgccgtgctggcgatcgtcggggtggcc
ggcgccgcgcccgcgaaggcggagccgaagcccgagcccaagccggagcccaaggccgag
gcgaagcccgagccgaagccggagccgaaggtcgaggagcccacgccgggcgcgtcctac
aacgagccggccgccgaggcggagcaggccgcgcagccggccaaggccgagcaggcggcc
cagccggccgcgccggccgccgcgcagcgcccgagcgttccgtccgagtacggcgaggac
gccgccgggtacgtgacgccgctggtgcgcaagctcgccgccgagcacggcgtggacctg
ggctcgatcaagggcaccggcgtgggtggccgcatccgcaagcaggacgtgctggaggcg
gccgagaaggcgaaggccgccaagcccgcaccggccgccgccgctgccccgtccgcaccc
gccccggccaagccggccgccaagccggagccgagcgccaagcggggcaccacggagaag
ctgccgcggatccgttcgatcatcgccaagcgtctccagcagtcgctgcacgagacggcg
cagctgaccaccgtcgtcgaggtcgacgtcaccaaggtcgccaagctgcgggcgcgggcc
aaggactcgttccaggccaagcacggcgtgaagctgtccttcctgccgttcttcgcggtg
gccgcgatcgaggcgctccagacgtacccgatcatccaggccagcatggacctggacggc
gggacgatcacctacccgggcgccgagcacctgggcatcgcggtggacaccgagcgcggg
ctgctcacgccggtcatccacaacgccggcgacctgaacatgggtggcctggccaagcgg
atcgccgacctggccgagcgcacccgggccaacaagatcaccccggacgagatggccggg
gcgacgttcacgctcaccaacaccggcagccggggcgcgctgttcgacaccccgatcgtg
ccgtcgccgcagtcggcgatgctcggcacgggtgccgtggtgaagcgtccggtcgtggtg
aacgacgcggagctgggcgaggtcgtggcgatccggtcgatggtctacctggctctgtcg
tacgaccaccggctgatcgacggcgccgacgcggcccgcttcctcaccgcggtgaaggag
cggctggagggcggcaacttcgaggccgagctgggtctgtag

DBGET integrated database retrieval system