KEGG   Micromonospora sp. L5: ML5_3700Help
Entry
ML5_3700          CDS       T01379                                 

Definition
2-oxoglutarate dehydrogenase, e2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mil  Micromonospora sp. L5
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ML5_3700
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ML5_3700
  Amino acid metabolism
   00310 Lysine degradation
    ML5_3700
Enzymes [BR:mil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ML5_3700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3890576..3892417)
Genome map
AA seq 613 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLSRIV
VGEDETAEVGSELAVIAGEGEDAGAAPTEKAEPATEPTAAAEGTGPEPEQAQEAEEAAAE
PGAEAEQPAVEEPAEPAAPSGEGTPVTMPALGESVTEGTVTRWLKQVGETVEVDEPLLEV
STDKVDTEIPSPVAGTLQEIKVAEDETADVGAVLAIVGVAGAAPAKAEPKPEPKPEPKAE
AKPEPKPEPKVEEPTPGASYNEPAAEAEQAAQPAKAEQAAQPAAPAAAQRPSVPSEYGED
AAGYVTPLVRKLAAEHGVDLGSIKGTGVGGRIRKQDVLEAAEKAKAAKPAPAAAAAPSAP
APAKPAAKPEPSAKRGTTEKLPRIRSIIAKRLQQSLHETAQLTTVVEVDVTKVAKLRARA
KDSFQAKHGVKLSFLPFFAVAAIEALQTYPIIQASMDLDGGTITYPGAEHLGIAVDTERG
LLTPVIHNAGDLNMGGLAKRIADLAERTRANKITPDEMAGATFTLTNTGSRGALFDTPIV
PSPQSAMLGTGAVVKRPVVVNDAELGEVVAIRSMVYLALSYDHRLIDGADAARFLTAVKE
RLEGGNFEAELGL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggcgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggtgacaccgtcgaggtcgacgagcccctgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtcccccgcggcgggcgtgctgagccggatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcggtcatcgccggcgagggc
gaggacgcgggcgcggctcccacggagaaggccgagccggccaccgagccgacggccgcc
gccgagggcaccggccccgagccggagcaggcccaggaggccgaggaggccgccgccgag
ccgggcgccgaggccgagcagccggccgtcgaggagccggccgagcccgccgcgccgtcg
ggcgagggcacgccggtgaccatgccggccctgggcgagagcgtcaccgagggtactgtc
acccgctggctcaagcaggtcggcgagaccgtcgaggtggacgagccgctgctggaggtc
tccaccgacaaggtcgacaccgagatcccgtcgccggtcgccggcacgctgcaggagatc
aaggtcgccgaggacgagaccgccgacgtcggcgccgtgctggcgatcgtcggggtggcc
ggcgccgcgcccgcgaaggcggagccgaagcccgagcccaagccggagcccaaggccgag
gcgaagcccgagccgaagccggagccgaaggtcgaggagcccacgccgggcgcgtcctac
aacgagccggccgccgaggcggagcaggccgcgcagccggccaaggccgagcaggcggcc
cagccggccgcgccggccgccgcgcagcgcccgagcgttccgtccgagtacggcgaggac
gccgccgggtacgtgacgccgctggtgcgcaagctcgccgccgagcacggcgtggacctg
ggctcgatcaagggcaccggcgtgggtggccgcatccgcaagcaggacgtgctggaggcg
gccgagaaggcgaaggccgccaagcccgcaccggccgccgccgctgccccgtccgcaccc
gccccggccaagccggccgccaagccggagccgagcgccaagcggggcaccacggagaag
ctgccgcggatccgttcgatcatcgccaagcgtctccagcagtcgctgcacgagacggcg
cagctgaccaccgtcgtcgaggtcgacgtcaccaaggtcgccaagctgcgggcgcgggcc
aaggactcgttccaggccaagcacggcgtgaagctgtccttcctgccgttcttcgcggtg
gccgcgatcgaggcgctccagacgtacccgatcatccaggccagcatggacctggacggc
gggacgatcacctacccgggcgccgagcacctgggcatcgcggtggacaccgagcgcggg
ctgctcacgccggtcatccacaacgccggcgacctgaacatgggtggcctggccaagcgg
atcgccgacctggccgagcgcacccgggccaacaagatcaccccggacgagatggccggg
gcgacgttcacgctcaccaacaccggcagccggggcgcgctgttcgacaccccgatcgtg
ccgtcgccgcagtcggcgatgctcggcacgggtgccgtggtgaagcgtccggtcgtggtg
aacgacgcggagctgggcgaggtcgtggcgatccggtcgatggtctacctggctctgtcg
tacgaccaccggctgatcgacggcgccgacgcggcccgcttcctcaccgcggtgaaggag
cggctggagggcggcaacttcgaggccgagctgggtctgtag

DBGET integrated database retrieval system