KEGG   Micromonospora sp. L5: ML5_3723Help
Entry
ML5_3723          CDS       T01379                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mil  Micromonospora sp. L5
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ML5_3723
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ML5_3723
Enzymes [BR:mil01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ML5_3723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3916197..3917630)
Genome map
AA seq 477 aa AA seqDB search
MTAFRVAMNFVHPSLDTAAPNALEVALTDDVLVVHGGTPLEGRIRVRGAKNLVSKAMVAA
LLGDTPSRLFDVPRIRDVEVVRGLLGLHGVKVSDGVEEGELVFDPTNVESASTDQINVHA
GSSRIPILFCGPLLHRLGHAFIPDLGGCHIGPRPIDFHLQALREFGATVEKTPEGLHLSA
PNGLHGTKFALPYPSVGATEQVLLTAVMAEGVTELRNAAVEPEIIDLICVLQKMGAIIKV
HTDRVIEIQGVKKLHGYTHRPIPDRIEAASWAAAALATRGHVEVLGAQQADMMTFLNIFR
SVGGEYEVTDLRPPRGGSPGQEGGIRFWHPGGELNAVALETDVHPGFMTDWQQPLVVALT
QARGLSIVHETVYEQRLGYTEALNTMGANIQVYRDCLGGTPCRFGRRNFKHSAVIAGPSK
LHAADLVIPDLRAGFSHLIAALAAEGTSRVYGVDLINRGYEDFEAKLADLGAHVERP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgttccgggtagcgatgaacttcgtgcacccatcactagacacggcagcaccc
aacgcgctggaggttgcgttgaccgacgacgtcctggtcgtacacggaggcactccgctt
gaagggcggatccgcgtgcgcggcgcgaagaacctggtgtccaaggcgatggtggccgcc
ctgctgggcgacacaccgagccggctgttcgacgtgccgcgtatccgtgacgtcgaggtg
gtccgcggtctgctcggcctgcacggcgtgaaggtcagcgacggcgtggaggagggcgaa
ctcgtcttcgaccccacgaacgtcgagagcgccagcaccgaccagatcaacgtgcacgcc
gggtccagccgcatcccgatcctgttctgcggcccgctgctgcaccggctcggccacgcc
ttcatccccgacctgggcggctgccacatcggcccgcgcccgatcgacttccacctccag
gcgctgcgcgagttcggggccaccgtcgagaagacgccggagggcctgcacctgtccgcg
cccaacgggctgcacggcacgaagttcgcgctgccgtacccgagcgtgggcgccaccgag
caggtgctgctcaccgcggtgatggccgagggcgtcaccgaactgcgcaacgcggcggtc
gagccggagatcatcgacctcatctgcgtgctccagaagatgggcgcgatcatcaaggtg
cacaccgaccgggtgatcgagatccagggcgtcaagaagctgcacggctacacccaccgg
ccgatcccggaccggatcgaggcggccagctgggcggcggcggcgctggcgacccgcggt
cacgtcgaggtgctgggcgcccagcaggccgacatgatgaccttcctgaacatcttccgg
tcggtcggcggcgagtacgaggtcaccgacctgcgtccgccgcgcggcggcagcccgggc
caggagggcggcatccggttctggcacccgggcggtgagctgaacgcggtggcgctggag
accgacgtgcaccccggtttcatgaccgactggcagcagccgctggtggtcgcgctcacc
caggcccggggcctgtcgatcgtccacgagacggtctacgagcagcggctcggctacacc
gaggcgctgaacacgatgggcgccaacatccaggtctaccgggactgcctcggcggcacc
ccgtgccgcttcggccggcgcaacttcaagcactccgcggtgatcgccgggccgagcaag
ctgcacgcggccgacctggtcatcccggacctgcgggccgggttcagccacctgatcgcg
gcgctggccgccgagggcacctcccgggtgtacggcgtggacctgatcaaccgcggctac
gaggacttcgaggccaagctggccgacctcggcgcccacgtcgagcgtccctga

DBGET integrated database retrieval system