KEGG   Micromonospora sp. L5: ML5_3788Help
Entry
ML5_3788          CDS       T01379                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mil  Micromonospora sp. L5
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ML5_3788
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ML5_3788
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ML5_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3984362..3984850)
Genome map
AA seq 162 aa AA seqDB search
MTVFDVQIDALTGGPADLGRYRGRALLVVNVASRCGLTPQYAGLQELADTYAGRGLTVLG
VPCNQFAGQEPGSAAEIEEFCQVNYGVTFPLTEKVDVNGPDRHPLYAELVSTPDAEGHTG
DVRWNFEKFLVAPDGTVAARFGPQVTPEDPELRAAIEKALPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttttcgacgtccagatcgacgccctcaccggcggcccggctgacctcggccgc
taccgcggccgcgccctgctcgtggtcaatgtggcctcccgctgcggcctcaccccgcag
tacgcgggccttcaggaactcgccgacacgtacgccggacgcgggctgacggtgctcggg
gtgccgtgcaaccagttcgccggccaggagccgggcagcgccgccgagatcgaggagttc
tgccaggtcaactacggcgtgacgttcccgctgacggaaaaggtcgatgtcaacgggccg
gaccggcacccgctctacgcggagctggtgtccacgccggacgccgaggggcacaccggc
gacgtgcgctggaacttcgagaagttcctcgtcgcgccggacggcacggtggccgcccgg
ttcggcccgcaggtcacacccgaggatcccgagctgcgcgcggcgatcgagaaggccctg
ccggcctga

DBGET integrated database retrieval system