KEGG   Micromonospora sp. L5: ML5_3826Help
Entry
ML5_3826          CDS       T01379                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mil  Micromonospora sp. L5
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ML5_3826
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ML5_3826
Enzymes [BR:mil01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ML5_3826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4031000..4032523
Genome map
AA seq 507 aa AA seqDB search
MPGNPRPTTVRPVRLGDLADRVAATPPEEAADLAVTGVTHASQEVRPGDLYAALPGARRH
GAEFAAAAAEAGAVALLTDPAGVALAAGTGLPVLVVADPRDALGEVAATVYGDPTAGLTV
IGVTGTAGKTSTSYLVESGLRAAGHVTGLIGTVETRLGDLVIDSVRTTPEATDLHAMLAV
AREHGVDTVVMEVSSHALAMGRVGGVRFDVGGYTNFGSDHLDFHADEADYFAAKAKLFDG
RCRVEVLNHDDPALRPLHKPGTVTYSAAGDPDATWWADGIDGEGYAQRFTLHGPDGLALP
TGVALPGRHNVANALLAVALLVAVGVDPETAARGVAACGGVPGRLELVSGDAPVRGVVDY
AHKANAIEAVLIALRDLTEGRLICVLGAGGDRDRGKRPVMGGVAARGADVVLVTDDNPRT
EDPAAIRAEVLAGAYAAATPARVIEVPGRRAAIEEAVRMAEPGDVVAVLGKGQERGQEIG
GEVLPFDDRVELAAALRARFGDLVGQR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcaatccacgtcccacaaccgtgcgtcccgtacggctcggcgacctcgccgac
cgcgtggcggcgaccccgccggaggaggccgccgacctggccgtcaccggcgtgacccac
gccagccaggaggtgcgccccggcgacctgtacgccgccctgcccggtgcccggcgccac
ggcgcggagttcgccgcagcggcggcggaggcgggcgcggtggccctgctgaccgacccg
gccggtgtggcgctggccgccgggaccggcctgcccgtgctcgtcgtcgccgacccgcgc
gacgcgctcggcgaggtggccgcgaccgtctacggcgacccgaccgccggcctgaccgtg
atcggggtgaccggcaccgccggcaagacctccaccagttacctggtcgagtcggggctg
cgggccgccgggcacgtcaccgggctgatcggcaccgtggagacccgcctcggcgacctg
gtgatcgacagcgtccggaccaccccggaggccaccgacctgcacgccatgctcgcggtg
gcccgcgagcacggggtggacaccgtggtcatggaggtgtccagccacgccctcgccatg
ggccgggtcggcggcgtccggttcgacgtcggcggctacaccaacttcggctccgaccac
ctggacttccacgccgacgaggcggactacttcgcggccaaggccaagctgttcgacggc
cgctgccgggtcgaggtgctcaaccacgacgacccggcgctgcgtccgctgcacaagccg
ggcaccgtcacctactcggcggccggcgacccggacgcgacctggtgggccgacgggatc
gacggcgagggctacgcgcagcgcttcacgctgcacgggccggacggtctggcgctgccc
accggcgtggcgctgcccggccggcacaacgtggcgaacgcgctgctggcggtcgccctg
ctggtcgccgtcggggtggacccggagaccgcggcgcgcggcgtagccgcctgcggtggc
gtgcccggccggctggaactggtcagcggcgacgccccggtgcgcggcgtggtcgactac
gcgcacaaggccaacgcgatcgaggcggtgctcatcgcgctgcgcgacctgaccgaaggc
cggctgatctgcgtgctgggcgccggcggcgaccgggaccggggcaagcggccggtgatg
ggcggcgtggccgcgcgcggcgccgacgtggtgctcgtgaccgacgacaacccgcggacg
gaggacccggccgcgatccgggccgaggtgctcgccggcgcgtacgccgccgcgaccccg
gcccgcgtcatcgaggtgcccgggcggcgggcggcgatcgaggaggcggtccggatggcc
gaaccgggtgacgtggtggcggtgctgggcaagggccaggaacgcggccaggagatcggc
ggcgaggtgctgccgttcgacgaccgggtggagctggcggcggcgctgcgcgcccgcttc
ggtgacctggtgggtcagcggtga

DBGET integrated database retrieval system