KEGG   Micromonospora sp. L5: ML5_3848Help
Entry
ML5_3848          CDS       T01379                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mil  Micromonospora sp. L5
Pathway
mil00340  Histidine metabolism
mil01100  Metabolic pathways
mil01110  Biosynthesis of secondary metabolites
mil01230  Biosynthesis of amino acids
Module
mil_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mil00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ML5_3848
Enzymes [BR:mil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ML5_3848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADU09359
JGI: ML5_3848
Position
4053511..4054836
Genome map
AA seq 441 aa AA seqDB search
MLNRIDLRGGARDPRRLLPRAQLDVSVAVERIRPLVEAVRDHGYPAIREASERFDGVSPE
RLRVPVETIRAAEDELDPQVRAALLESITRARKVHADQRRTDHTTTVVPGGTVTERWVPV
DRVGLYVPGGLAMYPSTVVMNVVPAQAAGVRSLVVVSPPQKDNDGLPDRRVLAACALLGV
DEVYAVGGAQAVAMLAYGAGVDPAGDERCEPVDMITGPGNIWVTAAKRLLRGVVGIDAEA
GPTEIAILADDTADPAHVAADLISQAEHDPLAASVLVTPSTALADAVDAELARQAPAAKH
AERIGTALRGEQSGVVLVDDLEAGLRVVDAYAAEHLEIQTENARDWALRVRNAGAVFVGA
WSPVSLGDYCAGSNHVLPTGGCARHSSGLSVQSFLRGVHLVEYTQDALRDVAPHVVTLAT
VEDLPAHGQAVSVRFPGGGPS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaatcggatcgacctgcgcggcggggcccgtgacccgcgccgcctgctgccccgt
gcccagctcgacgtctccgtggcggtcgagcggatccgcccgctcgtggaggcggtccgg
gaccatgggtacccggcgatccgggaggcgagcgaacggttcgacggcgtctcgccggag
cggctgcgggtgccggtcgagacgatccgcgccgccgaggacgagctggacccgcaggta
cgcgccgcgctgctggagtcgatcacccgggcccgcaaggtccacgccgaccagcgccgc
accgaccacaccacgactgtggtgcccggcggcactgtgaccgagcggtgggtgccggtc
gaccgggtcggtctctacgtgcccggcggcctggccatgtacccgtcgacggtggtgatg
aacgtggtcccggcccaggcggctggggtgcgctccctggtggtggtgagcccgccgcag
aaggacaacgacgggctgccggaccgccgggtcctcgcggcgtgcgcgctgctcggcgtg
gacgaggtgtacgcggtcggcggcgcccaggcggtcgccatgctcgcgtacggcgcgggc
gtcgacccggccggggacgagcgctgcgagccggtcgacatgatcaccggtccgggcaac
atctgggtcaccgccgcgaagcggctgctgcgcggcgtggtcggcatcgacgccgaggcc
ggcccgaccgagatcgcgatcctggccgacgacaccgccgacccggcgcacgtcgcggcc
gacctgatcagccaggccgagcacgaccccctcgccgcgagcgtgctggtcaccccgtcc
acggcgctggccgacgcggtcgacgcggagctggcccggcaggcgccggcggccaagcac
gccgagcggatcggcaccgcgctgcgcggcgagcagagcggcgtggtcctggtcgacgac
ctggaggcagggctgcgggtggtcgacgcgtacgcggccgagcacctggagatccagacc
gagaacgcccgcgactgggcgctgcgggtccgcaacgccggggcggtgttcgtcggcgcc
tggtcgccggtgtcgctcggcgactactgcgcgggctccaaccacgtgctgcccaccggc
ggctgcgcccggcactcctccgggctgtccgtgcagtcgttcctgcgcggcgtgcacctg
gtcgaatacacccaggacgcgctgcgcgacgtggcgccgcacgtggtcacgctggcgacc
gtggaggacctgcccgcgcacggccaggcggtcagcgtccggttccccgggggcggcccg
tcgtga

DBGET integrated database retrieval system